(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE114

PENCW_13.PE114       Location/Qualifiers
FT   CDS_pept        join(256421..257010,257089..258076)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977306"
FT                   /orf_name="Pc16g01140"
FT                   /product="Pc16g01140 protein"
FT                   /protein_id="CAP92784.1"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI00018314E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H716"
FT                   /transl_table=1
FT                   /translation="MTTLLTPRETHSPFSDPLRCPTGPTAQRYFLEDHAIPRKSPMQDD
FT                   YRARDSSPVASNLPSALPSPGFAPIPEQLAYASTLNSLSPENELALPSYDTESLHNPKG
FT                   PEDVSDASTDSHPPSWTLQAPSADDTLIEDEPSRHVDYLSHDWKEEDIWSSWRYVTSRR
FT                   NDYSNGVRLENASWRTWAKAKHNLKTVSPESLNWLKDCDVTWLYGPLKSSVERATSLSP
FT                   PPSRLETPNSYLDRKPILKKKTASEAILQRSLSQHTLLQHAGAILKAQEAENNWARPPF
FT                   PRSNTDLDHLHHRTGSSTYSLGGTLTASSSSGMTSPSERRHIHFNNEVVQCIAVEAKGY
FT                   EDDWPATFEDEPSSDDGVVLMRQISSRSSLSNCTTPRNSFNDGKTIAPLPSTTLKYRGD
FT                   PPGAQTILDRWSTPTRTLSPTPSVETIRPSEPSGQSEPSEPSANFLLDECEDPSLDFTG
FT                   NYPDRDRAWFIEDDPASGRPLRLTASGMIMPEGESESPSSSILDRVVDTVNTARDIAHV
FT                   IWNVGWRR"
     atgacgacgt tgttgactcc ccgcgaaacc cattcgccct tctcggatcc tctacggtgt        60
     cccactggtc ccactgcgca gcgttatttc ctcgaagatc acgccatccc cagaaaatcg       120
     cccatgcaag atgactatcg cgcgagggac tcctccccag tcgcatcaaa tctaccctct       180
     gcgctccctt ctccgggctt cgctcctatc cccgagcaac tcgcctacgc gtccactcta       240
     aatagcctgt caccggaaaa cgaactcgcc ctaccttcct acgacacaga atcccttcac       300
     aaccccaaag gaccagagga cgtgagtgac gcgtcgacag attcacaccc accttcgtgg       360
     acattacagg ctccatcggc agatgacacc ttaattgagg atgagccatc caggcacgtg       420
     gactaccttt cacatgactg gaaggaggag gatatttggt cctcctggcg ttatgtgacg       480
     agtcggagga acgattatag taatggagtg agattggaga atgcctcttg gaggacatgg       540
     gccaaggcca agcataatct gaagacggta tcaccggaaa gcctcaattg gctgaaggac       600
     tgcgatgtca cctggctcta tgggccatta aaaagctccg tcgaacgtgc aacctctcta       660
     tctccccctc caagtcgctt agagacaccg aactcttatc tagaccgaaa gccgatcctg       720
     aagaagaaga ccgcgtccga ggccatcctc cagcggtcac tatctcaaca tacgttactt       780
     caacatgccg gggccattct caaggctcaa gaagccgaga acaactgggc tcgaccccct       840
     ttcccaaggt ccaacacaga cctggatcat ttgcatcacc ggactggaag ttcgacctac       900
     tctctcggtg gcacactcac tgcctcctca tcatctggaa tgacgtctcc aagcgaacgg       960
     cgccatatcc acttcaacaa tgaagtcgtg caatgcattg cagttgaggc caagggctac      1020
     gaggacgatt ggccggccac ctttgaagat gagccatctt cggacgacgg cgtagtcttg      1080
     atgagacaga tctccagccg gtcctccctg agcaactgca ccaccccacg caacagcttc      1140
     aacgatggga aaaccatcgc ccctctcccc tcaaccacgc tcaagtatcg cggggatccc      1200
     cccggtgctc agacgatcct cgaccgatgg tccaccccca cccgaacact atcaccaact      1260
     ccgtctgtgg agaccatacg tccgtcagag ccatcaggcc aatcagagcc atcagagcct      1320
     tcggcaaact tccttttgga tgagtgtgaa gatcctagcc tggacttcac gggcaactac      1380
     cccgatcgtg atcgcgcatg gttcatcgaa gatgatccag catcaggtcg cccgctccga      1440
     ttgactgctt cgggcatgat catgccggaa ggcgagtccg agtcccccag cagtagtatt      1500
     ttggaccgtg ttgtggacac cgtgaacaca gcccgggaca ttgcccatgt aatttggaat      1560
     gtgggctggc gccgctaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page