(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE115

PENCW_13.PE115       Location/Qualifiers
FT   CDS_pept        join(258658..258924,259016..260390,260471..260925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128405"
FT                   /orf_name="Pc16g01150"
FT                   /product="Pc16g01150 protein"
FT                   /function="binding"
FT                   /biological_process="phagocytosis"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP92785.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006909"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018314E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H717"
FT                   /transl_table=1
FT                   /translation="METVNVAELVERLGSDEDAVRKMAVFKLQGNIGDPSFADIFIAEG
FT                   GLVRLRYLTLHASGNTLAYSLASFSRLLDVDKGWECVDQELVERIVELIVTHPLVNILR
FT                   GAMSILVSIVSHPYTGNRTSQVNNFGFRALKPAIAIYPQFLEMLVSRLSSADHALCANA
FT                   LQLINSLMRDSITHDPEAEWPKFIQKLQDLGVIRAVYVLMQDSALQDLAHPLLEFQSLT
FT                   KVLLRKWRDIPVNQEKPEHRRALKGIYLASNPEKNSDEATENGDSARPSRRHHPEKWRR
FT                   LGFETESPAGEFYEVGFLGMMDLADYVRSHGDEFQNMLLEHSTKPSRQRCPIARASLAV
FT                   TSILYEHFEVEKSDMDDTKTYLISESRTGFDKLFQPLLLHWTRLHVAGLQAFFRLWKAT
FT                   AAEEEDLDKLIELVRILIGSVVGGAARIKDVQDVEEELADFEYHRLRGLQMELLELTYE
FT                   DAWGQHLRQVREELHHEALQFVKEQRIRSLLQGSWFALDSHPKSESGPVQKSTATYQYA
FT                   QLSHNRRYLHFGQFDLMGDRPPELDTLPEKIDLSIVSSVVSNVSTNPDHSSTATVKTAP
FT                   RQPTTKITIHGYVPSTATGHGKGHSHARSGSRTTQKEVVLLTLRPSSHIIASEWLDGLL
FT                   MLLNQQPITAETSKLIDLVSDYGLKIRLLNVRFDDATFAGEAPQVPARDGLDEDYYYDV
FT                   FGGV"
     atggaaaccg tcaatgtcgc cgaattggtc gagcgcctgg gtagcgatga agatgccgtg        60
     cgcaaaatgg ctgtcttcaa gctccagggc aacatcggag acccgtcctt cgccgacatc       120
     ttcatcgcag agggcgggct ggttcgatta cgctacttaa ctctccacgc aagcgggaac       180
     accttggcat atagtttggc cagtttctcg agactgctcg atgtcgataa ggggtgggag       240
     tgtgttgacc aggagttggt tgagcgcatt gtcgagctta tcgtcaccca tcccctagta       300
     aacatcctcc gcggcgccat gtccattctc gtctcgattg tttcccaccc gtacacgggg       360
     aaccgcacct cccaggtcaa caactttggt ttccgcgccc tgaagcctgc aatcgccata       420
     tacccccaat tcctcgagat gctcgtcagt cgattatcct ccgcggacca tgcgctgtgt       480
     gccaatgcgc tccaattgat caactcgctc atgcgcgact cgatcaccca cgaccccgag       540
     gcggagtggc ccaagttcat tcaaaaatta caggacctgg gtgttatcag agcggtgtat       600
     gtgcttatgc aggattccgc ccttcaggac ctggcgcatc cgctgctgga attccagtcg       660
     ctcaccaagg tcctgctacg caagtggcga gatatccccg tcaaccagga gaagcctgag       720
     catcgccgcg cgctgaaggg aatctatttg gccagtaacc cggagaagaa ttccgacgag       780
     gctaccgaga atggcgatag tgcacggccc tctagacgac accatccaga aaagtggagg       840
     cggcttggat ttgagacgga gagtccggcg ggagaattct atgaggtcgg tttcctgggt       900
     atgatggacc tggcggacta tgttcgcagt catggggatg agtttcaaaa tatgctcttg       960
     gagcactcta caaagccatc acgacaacgt tgtccgattg ctcgggcatc attggccgtc      1020
     acatccatct tatacgagca tttcgaggtg gaaaagtccg acatggatga caccaaaaca      1080
     tatctcattt cagagtcccg tacgggcttt gataaactgt tccagccatt gctgttacat      1140
     tggacccgat tacatgttgc cggcttacag gccttcttcc gcctgtggaa ggcgaccgct      1200
     gccgaggaag aggacttgga caagcttatc gagctcgtgc gcatcctcat cgggtcggtg      1260
     gttggcggag ctgctcggat taaggatgtt caggacgtcg aagaggaact ggccgatttc      1320
     gaataccacc gattgcgcgg gctgcaaatg gaacttcttg aacttacgta cgaggatgca      1380
     tggggccagc acttgcgaca ggtgcgcgag gaacttcacc atgaggctct ccagttcgta      1440
     aaggagcaac gaatccgatc tctgctccaa ggtagctggt tcgctctgga ctcccacccc      1500
     aaatcggagt ctggcccggt gcagaagtct actgctacgt accaatacgc ccagctctct      1560
     cataaccgac gatatttgca tttcggtcaa tttgacctaa tgggcgaccg acctccggag      1620
     ttggacaccc taccagagaa aatcgatctc tcgatcgtat catctgtagt ctccaacgtc      1680
     tctactaacc cagatcattc ctctacagcc accgtgaaga ccgcaccccg tcaacccaca      1740
     accaagatca ccatccacgg ctacgtgccc tccacagcca ccggacacgg aaagggccac      1800
     agccacgccc ggtccggcag caggaccacc caaaaggagg tggtgctgct cacactgcgg      1860
     ccctcctcgc acatcattgc gtccgaatgg ctggatggtc tgctgatgct cctcaaccag      1920
     caacccatca ctgcagagac aagcaagctg attgacctgg tcagcgacta tgggttgaaa      1980
     atccgcctgc ttaatgtgcg gtttgacgat gccaccttcg ccggtgaggc tccccaggtc      2040
     cctgcgaggg atggtttgga tgaagattat tactatgatg tattcggagg cgtatag         2097
//

If you have problems or comments...

PBIL Back to PBIL home page