(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE116

PENCW_13.PE116       Location/Qualifiers
FT   CDS_pept        join(261254..261985,262052..263821)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671367"
FT                   /orf_name="Pc16g01160"
FT                   /product="Pc16g01160 protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92786.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI00018314E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H718"
FT                   /transl_table=1
FT                   /translation="MDGRPPKRQRRSKDSKDEPKIKPKRKPVISDSSSPIEPTEPFALS
FT                   SRPKPSYSRGTTPSTRPPSYSPSPNKKTEASPNQGPKSKSLHSFFQPATEGQRWAPQKT
FT                   EKQSLPPVRGTVDVDLIEDDYDSYDEIFTQHLANERAGMGLTAMSSSQIRQSAPKPAPK
FT                   PKAKAQVKPPRKTTKRFLLSTDRGDGTAKEPLAAQPANEPDRRPWAQRFAPANLGELAV
FT                   HKKKVSDVQHWLEDAFAGRRSERLLVLRGPAGSGKTTTVSLLSESLGYDIVEWKNPPVS
FT                   EFGARDYQSVSAHFEEFLGRGNKFGGLDLEDASELDSQKEEKPRDQRILLIEEFPTMLG
FT                   RASSALTAFRTSLQRYLAASANDHVRGSSGSNHPPIVIIVSETLLGSASSISDNMTVHR
FT                   LLGPTIYNHPGTTILDFNSIAPTFMHKALRSILDREARTSRRMQIPGPGVIDSISEIGD
FT                   IRSAISSLEFLCLKGDDTGRWGGNVAKTKKARGEVALTAMEKESLKMITQREASLGMFH
FT                   AVGKIVYNKRMDPSLIEGDVEILPPPPDYLRHYARPKASQVLVNDLADETGTDVSTFIS
FT                   ALHENYIPSCDGDDFTDCFNDCIDALSDSDILSADHRPGPGARAGIGTGITSFGSGVDV
FT                   LRQEEMSFQVAARGLLFALPYPVKRRVGPGAGRSRAGDAYKMFYPASLRLWREAEEIDG
FT                   LIDSWMNRSLDPFGQQQHLSQNGSDLSGVSSWKSLQVGRSASAYSKDKGDIPSVVTMMP
FT                   RHDLLLHQLPYMAAIRRQDPDCWQLDKITSIRVNQNLRDGIDDMEESPVPGSRMKSSSS
FT                   NGVGPRLAEEKLILSDDDIVD"
     atggacggtc gtcctcctaa aagacaacgc agatccaagg attcaaagga tgagccgaaa        60
     ataaaaccaa aacgaaaacc cgtcatttca gatagctcca gtcctatcga accaacagaa       120
     cccttcgcgc tctcctcacg cccaaaaccc tcctactcgc gcggcacaac accatcaact       180
     cggcccccct catattcgcc ctctccaaac aaaaagaccg aagcgtcacc aaatcaaggc       240
     ccaaaatcca agtccctcca cagcttcttc cagcccgcaa cagagggaca acgatgggca       300
     ccacaaaaga ccgagaagca gtccctcccg ccggtcaggg ggactgtcga cgtggacctg       360
     attgaagatg actacgactc ctacgatgaa atctttacac aacatctagc taacgagcga       420
     gcgggaatgg gtctgacggc catgagctcg agccagatac gtcagtcagc gccgaagcca       480
     gcaccaaagc caaaggcaaa ggcccaggtc aaaccgccgc ggaagacgac gaaacggttt       540
     cttctgtcta cggaccgtgg ggatggcact gccaaggagc cattggctgc gcaaccggct       600
     aatgaaccgg accgtcgacc gtgggctcag cggttcgctc cggccaacct aggcgaattg       660
     gctgttcata agaaaaaagt ctcggatgtg cagcattggc tggaagatgc ttttgctggg       720
     aggcgttctg agaggttact cgtcctacga ggtccggcag gcagtgggaa gacgaccact       780
     gtgtctttgc tctccgaatc acttggttac gacattgttg aatggaagaa tcccccggtt       840
     tcggaatttg gagctcgtga ttatcagtct gtgagtgcac acttcgagga gtttcttgga       900
     cgtgggaaca agtttggagg actggacctc gaagatgcca gcgagctcga ttcccagaaa       960
     gaagagaaac cccgggacca gcggatactt cttatagagg agtttccaac aatgcttggc      1020
     cgggcgtcct ccgccctcac agcgtttagg acgtctcttc agcgatattt ggctgcctct      1080
     gcgaatgacc atgtccgggg cagttctgga tcgaatcatc cacccatcgt gatcatcgtg      1140
     tcggaaactt tgctggggtc cgcgtcctcg atctcggata acatgacagt tcaccggtta      1200
     ctggggccca cgatctacaa ccaccccggg acaacgatat tggatttcaa tagcattgca      1260
     cccactttta tgcacaaggc tttgcggtct attttggaca gagaggcgcg gacttccagg      1320
     cgtatgcaga tacctgggcc gggtgttata gacagtatct ctgaaatcgg cgatatccgc      1380
     agtgcaatct cttctctcga attcctctgc ctcaaggggg acgatacagg gagatggggg      1440
     ggcaacgtgg ccaaaacaaa gaaagctcga ggtgaggttg ctttgacagc gatggagaaa      1500
     gagtctctca agatgataac ccagagagag gcgagcttgg gcatgtttca cgccgttggg      1560
     aagatcgtgt acaacaaacg catggaccct agtctgatcg agggcgatgt cgagatcctt      1620
     ccaccgccac cagactatct gcgccactat gcccgaccaa aagcttcgca ggtcttggtc      1680
     aatgatctgg ccgacgagac cgggactgac gtgtcgacgt tcatcagtgc cctccatgaa      1740
     aactacatcc catcctgtga tggggatgat ttcaccgact gtttcaacga ctgcatcgac      1800
     gccctctccg atagcgatat cctcagcgcc gatcaccgac cagggccagg ggcacgagcc      1860
     gggataggaa ctggaatcac ctctttcggt agcggcgtcg acgtgctccg gcaggaagaa      1920
     atgagtttcc aagttgccgc gcgtggtctc cttttcgccc ttccataccc ggtcaagaga      1980
     cgggttggac ctggagccgg acgaagccgc gcgggcgatg cctacaagat gttttaccca      2040
     gcatctctac gattgtggag agaggctgaa gaaattgatg gactgatcga ctcgtggatg      2100
     aaccgatcac tcgatccttt tggacagcag cagcacctct ctcagaatgg ctccgacctc      2160
     tcaggggtca gttcttggaa aagtctccag gttggaaggt cggcatcagc ctattcaaag      2220
     gataaaggtg acattccaag tgtggtcacg atgatgcctc ggcatgatct actgcttcat      2280
     caactaccat atatggctgc aatccgacgt caggacccgg attgttggca gttggataag      2340
     atcaccagca ttcgtgtcaa ccagaacctt cgtgatggaa ttgacgacat ggaagagtct      2400
     ccagtgccag gatcgcggat gaaatcatcc agcagtaatg gtgttggtcc ccgactggct      2460
     gaagagaaat tgattctcag tgacgatgat attgtcgatt ga                         2502
//

If you have problems or comments...

PBIL Back to PBIL home page