(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE117

PENCW_13.PE117       Location/Qualifiers
FT   CDS_pept        join(264059..264320,264498..265182,265258..265546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946601"
FT                   /orf_name="Pc16g01170"
FT                   /product="Pc16g01170 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92787.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00018314E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H719"
FT                   /transl_table=1
FT                   /translation="MLNDHEPSKRGPDDSYLINRTRVSVNPSGNTNFASKSRSRKSDEP
FT                   NYAQLKKDAPGLIAAAAHAAVPSWTSMVLMVSLIFGGCCANVELIRRPPSHIPNQIRSM
FT                   HTGPLITFAQFVLCALFTIPSFLSPSAGPRALFLNRRAIPLRSWVVYTAYFVSVNLLNN
FT                   WAFAYKISVPLHIILRSAGPVASMVIGYLYNGKRYSRGQIASVGMLTVGVAAAAIADAQ
FT                   SKGVSIHIDSDTADTATTVTGFTILALAMVLSAFQGIYADRLYATYGRDHWKEALFYSH
FT                   ALSLPLFLTSCPQLLGQWRVVASSPSLLSHLDSGWALLTQLPVQVAYLAMNALTQYLCI
FT                   RGVHLLSAKSSSLTVTIFLNVRKLVSLLLSIYLFGNHLAGGVLVGAALVFVGGGLYGFE
FT                   GARLRRVAKKAQ"
     atgttaaatg atcatgaacc ctcaaaacgt ggacctgatg actcttacct gatcaatcgc        60
     actcgagtct ctgtgaaccc atctggaaat accaacttcg cttcgaagtc tcgatctcga       120
     aaatctgatg agcctaacta tgctcaattg aagaaagatg ctccgggcct cattgctgct       180
     gccgcacatg cggcggttcc tagctggaca agcatggttc taatggtctc tcttatcttc       240
     ggcggctgct gtgccaacgt agaactaata agacgaccac catcgcatat tcctaaccaa       300
     atccgttcca tgcacacagg tcccttgatc acattcgccc aattcgttct ctgtgcgcta       360
     ttcaccatcc caagcttcct atccccctca gccggaccac gagccctatt cctgaaccga       420
     cgcgccatcc cactacgttc gtgggtggta tacaccgctt attttgtgag cgtcaacctc       480
     ctcaacaact gggccttcgc atataagatc tccgtcccgc tacacataat cctccgatct       540
     gcagggcccg tcgcctcaat ggtaattggc tacctataca acggcaaacg ctattcccgt       600
     ggccagatcg cttccgtagg gatgctgacg gtgggcgtgg cggcagccgc cattgccgac       660
     gcccaatcca aaggcgtgtc tatccacatc gactccgata cggcggacac agccacgacg       720
     gttacgggct tcacgatcct cgcactcgcg atggtcctct ctgcattcca ggggatctat       780
     gctgaccggc tgtacgcgac gtacggtagg gatcattgga aagaagcgct tttctactcc       840
     catgcgcttt ctctcccgct tttcttgacg agttgtccgc agttgctggg tcagtggcgg       900
     gtggtggctt catcaccttc tttgttatcg catctggatt ccgggtgggc tctcctgacg       960
     cagctgccgg ttcaggttgc ttacctggcg atgaatgcac tgacgcagta cttgtgtatc      1020
     cggggagtcc atcttttgtc agccaagtcc tcgtcgttga ctgttactat tttcttgaat      1080
     gttcgcaagt tggtttccct actcctgtcg atctatctct tcgggaatca tttggctggg      1140
     ggtgtcttgg tcggcgcggc tctggtgttt gtcggcggtg gtttgtatgg ctttgagggt      1200
     gcgcgcttac gaagagttgc caaaaaggcg cagtga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page