(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE118

PENCW_13.PE118       Location/Qualifiers
FT   CDS_pept        join(complement(268278..268376),complement(266211..268190),
FT                   complement(265835..266149))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946602"
FT                   /orf_name="Pc16g01180"
FT                   /product="Pc16g01180 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP92788.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00018314E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H720"
FT                   /transl_table=1
FT                   /translation="MTSLGEDLLVTVNKLQDLVFNTIGNDSLDLPQIVVVGSQSSGKSS
FT                   VLENIVGRDFLPRGSGIVTRRPLILQLINVPSERDDKPETDEIHIPHTAASVAGQHEWA
FT                   EFHHLPGRKFDDFGQVKQEIEAETARIAGSNKGINRQPINLKIFSPHVLNLTLVDLPGL
FT                   TKVPIGDQPSDIEKQTRTLILEYIAKPNSIILAVSPANVDLVNSEALKLARQVDAMGRR
FT                   TIGVLSKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQSGKSLADALRAESEF
FT                   FRHHPAYRNMANRCGTHFLAKTLNTTLMSHIRDRLPDIKARLNTLMGQTQQELASYGNK
FT                   QFSGEEHRGSLILQQMTRFAASFISSIDGTSSEISTKELCGGARIYYIFNSVFGNSLET
FT                   IDPTHNLTVSDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLESPSQRCVELVYEEL
FT                   IKICHTCGNQELLRFPRLQGKLIEVVSDLLRERLGPCSTYVESLISIQRAYINTNHPNF
FT                   LGAAAAMSSIMQNKQDEERKAVLAEEKRKREKRRQKELGAPNGNTGGPDEEEHADKQNL
FT                   PVRSHSSKGSRSMSPHVGRTGENGIAATLNGAHSNHAAFGGGASNTARDSFLNYFFGKE
FT                   GTHNTAMSPAGMNTNRQGPHAGEPSISQSIRRAEVRAPIMPTEEYAAPPEYGGDLSAFP
FT                   HENTEPALTDREMLETELIRRLISSYFNIVRETIADQVPKAVMHLLVNHCKDVVQNRLV
FT                   SELYKEDLFGELLYEDDGIKAEREKCERLLETYKEAAKIVGEVL"
     atgacatcgc tgggcgagga tctgctcgtg acagtgaaca agcttcagga tctggtcttc        60
     aataccattg ggaatgactc cttggatttg ccccaaattg ttgttgtcgg ttcccagtca       120
     tccggaaagt cttcggtcct agagaatata gtcggaaggg actttctacc aagaggtagc       180
     ggaattgtca cccggcggcc tctaatcctg caacttatca acgtgcccag tgaacgtgat       240
     gataagccgg aaaccgatga gatccatatc ccacacacgg ctgctagtgt tgccggtcaa       300
     cacgaatggg ccgaattcca ccacttgccg gggcgcaagt ttgatgactt tggacaagtg       360
     aagcaagaga tcgaagcaga aacggcaagg atcgcaggaa gcaacaaagg catcaataga       420
     cagccgatca acctcaagat cttctcgcct catgtgctca acctcacact cgtggatctg       480
     cctggactga caaaggtgcc tattggtgac cagccgtccg acattgagaa acagacacgc       540
     accttgattc tggaatatat cgccaaaccg aacagcatta tccttgcggt ctctccggcc       600
     aatgtcgatc ttgtcaattc cgaggcgctg aagcttgccc gccaggtgga tgccatgggc       660
     cggaggacga ttggagttct gtcaaagctg gatctcatgg accatggcac caatgcgatg       720
     gacatcctgt ctggacgtgt gtatcccttg aagcttggat ttattggcgt tgtcaaccgg       780
     tctcagcagg atatccaatc tggaaaatcg cttgccgatg cattgcgggc ggagtctgag       840
     ttcttccggc atcacccagc ttacaggaat atggccaacc gttgcggtac gcactttttg       900
     gccaagaccc tcaacacaac cctgatgtct cacattcgag acaggctccc ggatatcaag       960
     gctcggctga acaccttgat gggtcagact cagcaagagt tggccagcta tggaaacaaa      1020
     caattcagcg gcgaagaaca ccgggggtca ttgattcttc agcagatgac cagatttgcc      1080
     gcctcgttca tctcatccat cgacggaact tcatcggaga tctctaccaa agagctatgc      1140
     ggtggagcaa ggatttacta cattttcaac tctgtttttg ggaactcact ggaaacgatt      1200
     gatcccactc ataacctgac tgtttccgac atccgaacgg ccatccgaaa ctcgacaggt      1260
     cctcgcccca gcctgttcgt cccggagttg gcatttgatt tgctggtcaa accacaaatt      1320
     aaactcctcg aatcgcccag tcagcgctgc gtggagctgg tctacgagga gcttatcaag      1380
     atctgccaca catgcggcaa tcaggaactc ctgcgtttcc ctcgactcca aggaaagctg      1440
     attgaggtcg tatctgacct tcttcgtgag cgcctgggcc catgctcgac ttatgtagaa      1500
     tctttgatct caatccaaag agcttacatc aacaccaacc acccgaactt ccttggcgcc      1560
     gcagctgcca tgtcttcaat catgcagaac aagcaggacg aagaaagaaa ggccgtgctc      1620
     gcagaggaaa aaagaaagcg tgagaagcga cgtcagaagg aattgggagc tcccaatggc      1680
     aacacgggag gtcccgacga agaagaacat gctgacaagc aaaaccttcc cgttcgaagc      1740
     cactcctcta agggatcgcg gagcatgtct cctcatgttg gccgcactgg cgagaatggc      1800
     attgctgcta ctctgaatgg cgctcattct aaccatgctg cgttcggtgg tggtgcctca      1860
     aacactgctc gggactcgtt cctgaactac ttctttggca aggaaggcac tcacaatacg      1920
     gccatgtcgc cggcgggcat gaacaccaac cggcaagggc cacatgcagg tgagcccagc      1980
     attagccaga gcattaggcg tgccgaggtt cgggctccaa ttatgccgac ggaggagtac      2040
     gctgcaccac cagagtatgg cggtgacttg tctgccttcc cccatgagaa cacggagcct      2100
     gcactcacgg accgtgagat gctcgaaacg gagctcattc gccgtctcat ctcatcatac      2160
     tttaacatcg tccgagagac tattgcagat caggttccca aggctgtcat gcacctcctt      2220
     gtgaaccact gcaaggacgt agttcagaac agactcgtga gcgagcttta taaggaagat      2280
     ctctttggcg agcttcttta cgaggatgat ggcatcaagg cagagagaga gaagtgtgag      2340
     cggctgttgg aaacatacaa ggaagctgcc aagattgtgg gcgaggtgtt atag            2394
//

If you have problems or comments...

PBIL Back to PBIL home page