(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE119

PENCW_13.PE119       Location/Qualifiers
FT   CDS_pept        join(complement(271297..271498),complement(271052..271239),
FT                   complement(269089..270993),complement(268932..269018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946603"
FT                   /orf_name="Pc16g01190"
FT                   /product="Pc16g01190 protein"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92789.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI00018315D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H721"
FT                   /transl_table=1
FT                   /translation="MASLNLSSNGPSISKSYQTVVNAPPPSGNAGSPTYGQWVVYSVST
FT                   PLVSAFQQDGGKESVLKVQSTGEGELADLIEEFSEGRVQFAYVKVTDSNTGLSKNVLIG
FT                   WCGEGVPERTKGYFTSHLATVAKFLHGYHVQITARADGDLTPEGIIQRVADSSGSKYSV
FT                   GDAPAPAPAPRPVVASKPAFTPTRSGGITPSPAARVQPAPSTSDVTDDGWGADAPPVTR
FT                   TQLEKVQSAYQPTRVNLQELKANPTATRQPAATTNDSSDVVKGGYQPVGKVDIAAIRKQ
FT                   AAASGQLTDERPTIVKGSYEPVGKVDIAAIRARAQKPEGTSDNVSPSPAVNRQPATLPE
FT                   RPAPSNAASERLTTLPKPRVANKFGSSPSFPGTKPPLPTGIQPKPSSSAQIGAASRTFA
FT                   DEGGKTPAQIWAERKAKERGMASSPGSTETVSTPASIQSQTSGQGEWKSSYAGKSWAPV
FT                   QTAQEKTHIPEQPVDAKANDQQEEEPQPHVSSIHEQFAHDTPAPAPLAPPAPPVPQASR
FT                   PVPVLGLSSGPVESEPEHDVQQALPSPPPQPRSPTPPTPPVRESSPIQIAMPVGHSVAD
FT                   SVADVHEEQHSPPPAMPVHSLQEAVPDERDIEDDSHDLGRAAAEATAPQQHQQPQGGPR
FT                   AQIQYDYEKAEDNEIELREGEYVTDIEMVDPDWWVGVNTQGERGLFPANYVELLEDKEP
FT                   ASHATAGSHHYEPEPEPAAAPVPAASTPVTAAASSAATPSSKGVTATALYDYEAAEDNE
FT                   IGFPEDAKISNVEFPDDDWWLGEYNGKRGLFPANYVRLDE"
     atggcttctc tcaatctctc ctccaatggc ccctcgatat cgaaaagtta tcagacagtg        60
     gtgaatgcac cacccccttc tgggaatgca gggtctccca cttatggcca atgggtcgtc       120
     tactcagtct ctaccccgct tgtcagtgcc ttccagcaag atggaggtaa ggagagtgtc       180
     ctcaaggtcc agagcaccgg agagggtgaa ttggccgacc tcatcgagga attttccgaa       240
     ggacgggtgc aattcgccta tgtgaaagta acggactcca acactggcct ttcaaagaac       300
     gttctcattg gctggtgtgg agaaggtgtg ccggaacgaa caaagggtta ctttaccagc       360
     cacctggcta cagttgccaa gttccttcac ggataccatg tgcagatcac agcccgagca       420
     gatggggatc taacccccga gggaattatc cagcgagtgg cagattcctc cgggtccaag       480
     tattcagtgg gcgatgctcc tgccccggcc ccagcgcccc ggcctgtcgt ggctagcaag       540
     cctgctttca caccgactcg atccgggggt atcaccccca gcccagctgc tcgcgtgcag       600
     cccgcacctt caacgtctga cgtgactgac gatggatggg gtgcagacgc ccctcccgta       660
     acccgcaccc aattggaaaa ggtacagtcg gcttaccagc cgactagagt gaacctgcaa       720
     gaactcaagg caaaccccac agcgactcgc caacctgccg ctactaccaa tgattctagc       780
     gatgtggtta aaggtggtta ccagccagtg ggtaaagtcg atattgctgc aattcggaag       840
     caagctgccg catctggtca gctgacagat gagcgcccga cgattgtaaa gggttcttac       900
     gagcccgttg gaaaagtcga catcgctgct attcgggcta gagcacagaa gccggaaggc       960
     accagtgaca acgtctcacc gagccccgca gtcaatcgac agccagcaac gttgcccgag      1020
     cgacctgcgc cctctaacgc tgcttcggag cgcttgacca ccctacccaa accaagggtt      1080
     gccaacaagt ttggctctag tccctccttc cctggaacaa agccacccct cccaactggt      1140
     attcagccta agccaagctc gagtgcgcag attggagctg caagccgaac ttttgccgac      1200
     gagggaggca aaacacctgc tcaaatttgg gcagaacgca aggccaagga gcgcggaatg      1260
     gcttcgtcac ccgggagcac cgagactgtc tctacccctg cttcgattca gagccaaacc      1320
     agtggccagg gcgagtggaa gagctcctat gcgggcaagt cctgggctcc tgttcaaacc      1380
     gcacaggaga aaacacacat tcctgagcaa cctgttgatg caaaggccaa tgatcaacaa      1440
     gaggaggaac cgcaacccca cgtgagtagt attcatgagc aattcgctca tgacacgcct      1500
     gcgcctgcgc cactcgctcc tcctgcccca cctgttccgc aggccagtcg ccctgttcct      1560
     gtactggggc tgtcatctgg gcctgttgag tccgagcctg agcatgatgt ccagcaggct      1620
     cttccttctc ccccaccgca gcctcgctcc ccgacacctc ccactccccc agtgcgtgag      1680
     agctcaccga ttcagattgc catgccagtt ggccacagcg ttgccgacag tgttgccgat      1740
     gtccacgagg aacagcattc tcctccccct gctatgcctg tccatagcct ccaagaggcc      1800
     gttccggatg agagggatat tgaggacgat tctcacgatc tgggtcgtgc tgcggccgaa      1860
     gcaactgctc ctcagcagca ccagcagccc caaggtggac cgcgagccca gatccagtac      1920
     gactacgaga aggctgagga taatgagatt gaattgcggg agggagagta tgtgacggac      1980
     attgagatgg tggacccgga ttggtgggtg ggtgtcaata ctcagggtga gcgtggcctc      2040
     ttccccgcca actatgtgga gcttctggaa gacaaagaac ctgcgtcaca cgcaacggcc      2100
     ggttcccacc actatgaacc agagcccgag cctgctgctg cccccgttcc ggccgcatcc      2160
     acccctgtta ctgccgctgc gtcatcggcg gctactccaa gctccaaagg tgtcacagcg      2220
     accgctttgt atgactatga agccgccgag gataacgaga tcgggttccc tgaagacgcg      2280
     aagatttcca acgtggaatt cccggatgat gactggtggc ttggtgagta caatggaaaa      2340
     cgaggtctat tccctgccaa ctacgttcgc ctggacgaat ga                         2382
//

If you have problems or comments...

PBIL Back to PBIL home page