(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE120

PENCW_13.PE120       Location/Qualifiers
FT   CDS_pept        join(272479..273876,274024..275144,275208..275296,
FT                   275361..275647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977307"
FT                   /orf_name="Pc16g01200"
FT                   /product="Pc16g01200 protein"
FT                   /function="AMP deaminase activity"
FT                   /biological_process="purine base metabolic process "
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAP92790.1"
FT                   /db_xref="GO:0003876"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR016297"
FT                   /db_xref="UniParc:UPI00018315D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H722"
FT                   /transl_table=1
FT                   /translation="MGPPQPDLSSSRNANDSSNDESATSTPGLKSPMDSPLHESSDALD
FT                   QPTEDILPRDQQQKTATYDYAYEKSMSHAEARLFYQHHQLAARNDTTLPLSPVAPARSA
FT                   VELQPEEPPANITDPMNTQGQLSREGSMVLESEPSALRLQSASEPGPSASHFLEDDQDE
FT                   ANDPARNQAALLGAVYGQEPYSAAESLQSTGVGIRGPQVASGFASSGDAVTSELNAIYC
FT                   KIKKLLDRRSQYMDLSLQGPGNDPKDQPDWQIYPPPPEPAWDDGKEYQPGSLGDPSDVA
FT                   GKKRKMGQDIGEDFDMEELLPLPKESPWTYRLDGNSVYQVFDSEASADQQTPIVRIPSL
FT                   RDFYMDLDAVVDVSTDGPAKSFAFKRLSYLEGKFQLYTLLNEYQEMADSKKVPHRDFYN
FT                   VRKVDTHVHHSACMNQKHLLRFIKSKMRKSPDEVVLFRDGKHLTLREVFESINLTAYDL
FT                   SIDTLDMHAHTDSFHRFDKFNLKYNPVGESRLREIFLKTDNYIKGRYLAEITKEVISDL
FT                   ESSKYQMVEWRISIYGRSLQEWDKLAAWVVDNKLFSPNVRWLIQVPRLYDVYKASGMME
FT                   NFEQVITNVFQPLFEVTKDPSSHPKLHIFLQRVVGFDSVDDESKPERRLYRKYPIPREW
FT                   STKQNPPYTYWLYFMFANIASLNNWRKRRGFNTFVLRPHCGEAGDPDHLAVGFLCCHSI
FT                   SHGILLRKVPLLQYLYYLDQIGIAMSPLSNNALFLTYDKNPCATFFKRGLNVSLSTDDP
FT                   LQFAFTKEPLIEEYSVAAQIYKFSAVDMCELAKHSVDQSGFERSLKERWLGSNCSMPGV
FT                   AGNNVAKSNVPDIREAFRHETLLGELSLIERYSEGDVTGEQKSLAPSPPGVAVPSNHDH
FT                   HTSNLESQSELSSSAADTTDALPSETHGTNQMATSPSTPSTYLARSPRLGTGEFSSPSG
FT                   NPALGTGVGGPDGLPEQKIFPGIVHERARKGNMQ"
     atgggacctc cgcaacccga tctcagttcc agtcggaatg ccaacgattc ctctaacgat        60
     gaatcagcca cttcaacccc gggtctcaag agtcccatgg actctcctct ccacgaaagc       120
     tccgatgcac tagatcagcc tacagaggat attttgccca gagatcagca gcagaaaacg       180
     gccacctatg actatgccta tgagaagtca atgagtcacg ccgaggcaag actcttctat       240
     caacatcatc agctagccgc gcggaacgac accaccctac ctttgagccc agtcgcccca       300
     gcccgctcag cagtcgaatt acaacccgaa gagccaccgg ctaacattac ggatccgatg       360
     aatacccaag gccagctctc tcgcgaggga tctatggtcc ttgagtctga accctcggca       420
     ctacgcctgc aatccgccag tgagcctggt ccttctgcgt ctcatttcct tgaagatgac       480
     caggatgagg cgaacgatcc tgcccgaaac caggcggcgc ttctgggtgc cgtctatggg       540
     caggaaccat actcggcggc ggagagtcta caaagcaccg gggtggggat cagaggccca       600
     caagttgcta gcggatttgc gtctagcggt gatgctgtga cgtctgagct gaatgccatc       660
     tattgcaaaa tcaagaaatt acttgatcga cgatcccagt acatggatct ttctttgcag       720
     ggacccggaa atgatcctaa ggaccaaccg gactggcaga tctatcctcc gcctccagaa       780
     ccagcgtggg atgatggcaa agaatatcaa cccggtagcc tcggtgaccc atctgacgtt       840
     gcaggaaaga agaggaaaat gggccaggac attggggagg actttgacat ggaagaattg       900
     ttgcctctgc ccaaagaatc gccctggaca tataggctgg atggcaacag cgtatatcag       960
     gtctttgatt ccgaggcttc tgctgaccag cagacaccta ttgtccggat cccctcattg      1020
     cgcgatttct atatggatct ggacgccgtt gtggatgtgt cgaccgacgg acctgctaaa      1080
     agctttgcat tcaagcgatt gtcgtacttg gagggcaaat tccaattgta tacattgctc      1140
     aatgaatacc aggagatggc cgacagcaag aaggtccctc acagggactt ctataacgtg      1200
     cgcaaagtgg atacacatgt tcatcattcg gcatgcatga accagaaaca tcttcttcgc      1260
     ttcatcaaga gcaagatgag aaagtctccg gacgaagtcg tccttttccg agacggaaaa      1320
     catctgacct taagggaggt ctttgagagt atcaacttga ctgcttatga cctgagcatt      1380
     gatactctgg acatgcacgc acacaccgac tccttccacc gattcgacaa attcaacttg      1440
     aagtataatc cggttggaga atcccgactg cgtgaaattt tcctcaaaac agacaactac      1500
     atcaaaggtc gctacctcgc agagattacc aaggaagtaa tctcagactt ggagtctagc      1560
     aaataccaaa tggtggaatg gcgtatctcg atctacggtc gttcccttca ggaatgggac      1620
     aagcttgcgg cctgggtagt ggacaataag ttgttctcgc ctaacgttcg ctggcttatt      1680
     caagtgcctc gtctctatga tgtctacaaa gcaagcggca tgatggagaa ctttgaacaa      1740
     gtcatcacca atgtcttcca gccgctgttt gaagtgacca aggatccttc tagtcatccc      1800
     aaactccaca tcttccttca gcgagtggtt ggattcgaca gtgtggatga cgaaagcaaa      1860
     cccgagcgtc ggctgtacag aaagtatccc attccccggg agtggagcac caagcagaat      1920
     ccgccttaca cttactggct atacttcatg ttcgccaata ttgcttccct caacaactgg      1980
     aggaaacgcc gaggattcaa cacctttgtt ctacgccctc attgcggaga ggcaggcgat      2040
     ccggatcatc tggctgtcgg cttcctctgc tgccacagca tcagtcatgg tatcttgctg      2100
     cgcaaggttc ctctactgca gtacctttac tatctggatc agatcggcat tgccatgtca      2160
     ccactcagta acaacgcttt gttcctcaca tacgataaga acccctgcgc taccttcttc      2220
     aagcgaggac tcaatgtgtc attgtccacc gacgatccat tgcagtttgc attcacaaag      2280
     gagcctctca ttgaggaata ttcagtcgcc gcacagatct acaaattcag cgcagtcgac      2340
     atgtgcgaac tggcgaaaca ttcagttgac caaagtggat ttgagcgctc ccttaaagaa      2400
     agatggctcg gctcgaattg ttccatgcct ggagtcgctg gcaataatgt tgcaaagagc      2460
     aatgtaccag atattcgtga ggcattccgg catgagactt tgctcggaga attgtccttg      2520
     atcgagcgat attccgaggg cgatgtgacc ggggagcaga agagcttggc cccaagccca      2580
     ccaggggtag cggtgccctc gaatcatgat caccatacat ctaacctcga gtcccaatct      2640
     gagctgagtt caagtgcagc tgacactaca gatgccttac ccagcgaaac ccatggtaca      2700
     aatcagatgg ccacctcccc ttcgacgcca tcaacgtacc tagctcgatc acctcgcctt      2760
     ggaacgggtg agttctcgtc tcccagtggc aaccctgccc ttggaacagg ggttggggga      2820
     ccagacggtc tgccagagca gaagattttc ccgggcatcg ttcacgagag ggcgcgaaag      2880
     ggaaatatgc aatag                                                       2895
//

If you have problems or comments...

PBIL Back to PBIL home page