(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE121

PENCW_13.PE121       Location/Qualifiers
FT   CDS_pept        complement(275984..277843)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946604"
FT                   /orf_name="Pc16g01210"
FT                   /product="Pc16g01210 protein"
FT                   /protein_id="CAP92791.1"
FT                   /db_xref="UniParc:UPI00018315D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H723"
FT                   /transl_table=1
FT                   /translation="MGHPPEAHGKPSMPTEGCRSTAKLQDLTTPYECQPISSDNGHRAL
FT                   GSALSRSQVSPRAPRRFLAQPIETVSRSSNIQQSTLSGANQSAPSKPEIHSKGPCEQRS
FT                   TRRFLPEPIETSKTSNRRSHSTYEVHERNSASQSKTSTAPRRFKPDLIESDTRSVRKGE
FT                   PVRFVQRHNAVGSSAPHTITSPDTTLWSDTKPNAPTYLPSESQFSFSSLLRRQQARRHS
FT                   FRVPDLPSIPSNSSEESDNSRSHSACTSPPGPSNKASRDLCTSELPREICDGEISEFLL
FT                   SLAARSAQIQLKEQALAAFPNEQVYEPVDHFAIDEDDGDSDDYDVSMKYHHIKSRRQSS
FT                   ADLSWELEYMRHHKEEAEMRVRAMGASGQPKSSSEHNKNGKTPPMLGSDIVLPRSDSPE
FT                   GTICEHSSTDAASRGVDDLCTGCGDLWYAAPPRGGGKGAGLWKGTCCKDDGQEREVHGL
FT                   LPGIVTPMPRVDEAGISMGLSPSPSYTNLDRFEASPGNHSSRKPASPNLQKAIESEFHD
FT                   GFVTQIYNYLSLGYPCLARYYDYELSRISGISVEDLRRDDLQTDARGYLVASGKDDLAD
FT                   ICTRWKALRLYIQEWARQEPGMAEEDTNLEGWGLPERRGSWAI"
     atgggccacc ccccagaagc acatgggaaa cctagcatgc ccacggaggg gtgtcgatct        60
     acggccaaac tccaagatct gaccactcct tatgagtgtc agccaatttc ttcggataat       120
     ggacatcgag cactcggttc tgcactttca cgaagtcaag tatctcccag ggcccctcgg       180
     agattcctgg cccagccaat cgaaaccgta tcacgaagct ccaacatcca acagtccacc       240
     ttgagtggag caaaccaatc cgctccgtca aagcccgaaa tacactcaaa aggaccctgt       300
     gaacagcggt ccaccagaag attcctacct gaaccgattg aaacaagcaa aactagtaat       360
     agacggtctc attcgactta cgaggtacat gagaggaatt ctgcgtcaca aagcaagaca       420
     tcgaccgctc caagaagatt taagcccgac ctgatagaaa gcgacactcg ctcggttcga       480
     aaaggggaac ctgttcggtt tgtccaacgg cacaatgccg taggatcttc agcgccccat       540
     acaatcactt ctccagacac gacactgtgg tcagatacaa agccgaatgc gcccacttat       600
     ctgccatcag agtctcaatt ctcattttcc agtcttttgc gccgacaaca agcccgcagg       660
     cactcgtttc gagttccgga cctcccatcg atcccctcta acagcagcga agaatcggat       720
     aactccagat cgcattcggc gtgcacttca ccccctgggc cttccaataa agcgtcacgg       780
     gatctatgca cgagcgagtt accccgtgaa atttgcgacg gagagatctc ggaattcttg       840
     ctctctcttg ccgctcgatc tgcacagatc cagttgaagg agcaggcatt ggctgcgttt       900
     cccaacgagc aggtgtacga gcctgttgat catttcgcca tcgacgaaga cgatggggac       960
     tcggacgatt atgatgtgtc tatgaagtat catcatatca aatctcgacg acaatcttcg      1020
     gcagatttgt cctgggaact tgagtacatg cgccaccaca aggaggaggc tgaaatgagg      1080
     gtccgggcta tgggtgcatc tggacaacca aagtcttcat cagaacacaa taagaatggc      1140
     aagaccccgc ccatgcttgg cagtgacatc gtccttcctc gaagcgactc acccgaggga      1200
     acaatatgtg agcactctag cactgatgca gcctcccgtg gtgtggatga tctttgcact      1260
     ggctgtggtg acctgtggta cgcagcgcct cctcgtggcg gcggaaaggg tgctggactt      1320
     tggaagggca catgttgcaa agacgacggc caagagcggg aagtgcacgg tctcctacct      1380
     ggaattgtta cccccatgcc tcgtgtcgat gaggctggta ttagcatggg actcagccca      1440
     tctccttcat atacaaatct ggaccgtttc gaagcctcgc ccggaaacca tagttcccgg      1500
     aagcccgcga gccctaatct ccagaaagcc attgagtccg aatttcatga tggatttgtg      1560
     actcaaattt ataattactt gtctttgggt tacccgtgcc ttgcccgtta ctatgattac      1620
     gaactcagcc gaatttcggg catctcggtc gaggaccttc gccgggacga cttgcaaact      1680
     gatgctagag gctatcttgt ggcctcaggg aaggatgatc tcgcggatat ctgtacacgg      1740
     tggaaagctc tccgtctata tatccaggag tgggcgagac aggagcctgg catggctgaa      1800
     gaagatacaa atcttgaagg ctggggactc ccagaacgaa gaggcagctg ggctatttga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page