(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE129

PENCW_13.PE129       Location/Qualifiers
FT   CDS_pept        join(295939..296020,296055..296070,296209..296238,
FT                   296340..296352,296414..296430,296580..296616,
FT                   296972..296978,297070..297120,297323..297338,
FT                   297440..297452,297535..297564)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946606"
FT                   /orf_name="Pc16g01290"
FT                   /product="Putative uncharacterized protein Pc16g01290 "
FT                   /protein_id="CAP92799.1"
FT                   /db_xref="UniParc:UPI00018315D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H726"
FT                   /transl_table=1
FT                   /translation="MRSSLVKYVIGILGILVDFRIVAVSIINLGDRRLDFIVSYDYKSG
FT                   VRAIYPDSLYSRTIIKKLREVKDILGILVDFRAVAASIIIFSNYKSGVRVGFVLGRLS"
     atgcgcagct cgcttgtgaa atacgttata ggtatattag gtattttagt agacttccga        60
     atagtagcgg tctctataat taatttagga gatagaagat tagattttat agtctcttat       120
     gattataaat cgggggttag ggctatttat cccgattctt tatatagccg tactattata       180
     aagaaattaa gagaggtaaa ggatatatta ggtattttag tagacttccg agcggtcgcg       240
     gcctctataa ttatctttag taattataaa tcgggggtta gggtaggttt cgtcttaggc       300
     cgactatctt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page