(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE13

PENCW_13.PE13        Location/Qualifiers
FT   CDS_pept        join(30942..31187,31248..32021)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128153"
FT                   /orf_name="Pc16g00130"
FT                   /product="Pc16g00130 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92683.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831DAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2"
FT                   /transl_table=1
FT                   /translation="MVKFILVTGATGFIGAHIVDVLLARGIRVRGATRSLEKGDSMIKA
FT                   RPQHSGRLEFVQIDDFERPGGLVEAVQGVDGVIHTASPFTYNTRNNERELVRPAINGVR
FT                   AVLEAASTNPKIRRIVITSSFASVLDANRKGPLYFTYTGDDWNPLTYEESVDPATNAII
FT                   AYRGSKKFAELEAWKYVQEHSPKFDIVALCPPMTFGPVVHPVSHVDKLNESNLMLWKIA
FT                   NGENPLPVARVPFWIDVRDLAIAHVESLLRNEVGGKRYVPSSPERFSYGLAAKIIAEEF
FT                   PDLKTKVTQEDQVIDESCGLDGQTAAMELGYTYHLFHDTVRDLVSQTISLSERSPSCR"
     atggtcaaat ttatacttgt cacgggtgcg accggcttca tcggcgccca tatcgtcgac        60
     gtgttgctcg ctcgtggaat acgagtgcgc ggcgcgacgc ggtcactgga gaaaggcgat       120
     tctatgatca aggctcgtcc acagcactca gggagactgg agtttgttca aatcgatgac       180
     tttgaaaggc ccggtggctt agtggaagcc gttcaaggag tggatggagt gattcatacg       240
     gccagtccct tcacatacaa cacaaggaac aatgagcgcg agcttgtccg tcccgcaata       300
     aatggtgttc gagcagttct ggaagcggcc agcactaatc cgaaaatacg gcgcatcgtc       360
     attacttctt ccttcgcttc cgtccttgat gcgaatcgca agggccctct atatttcact       420
     tacactggtg atgattggaa ccctctgacc tatgaggagt ccgtggaccc ggccacgaat       480
     gccatcattg cgtaccgcgg gtcgaagaaa ttcgctgaac tggaggcttg gaaatatgtg       540
     caggaacaca gcccgaaatt cgatattgtc gccctgtgcc ctcctatgac atttggaccg       600
     gttgtgcatc ccgtttctca tgtggacaaa ctcaatgagt cgaatttgat gttgtggaag       660
     atcgctaatg gagaaaaccc tctacctgtt gcacgagtgc cgttctggat tgatgttcgc       720
     gaccttgcca tcgcacatgt cgagtcacta ctccggaacg aggtgggtgg gaaacgatac       780
     gttccgtcgt ccccagagcg attttcctat ggcctggctg caaagatcat agcggaagag       840
     ttccctgatc taaagaccaa agtcacacaa gaggaccaag ttattgacga gagctgtggg       900
     ttggatggtc aaactgctgc aatggaactg ggatatacgt atcatttatt tcatgatact       960
     gtgagggatc tggtatctca gacaatctcg ctgagcgaaa gatcacccag ctgccgatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page