(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE14

PENCW_13.PE14        Location/Qualifiers
FT   CDS_pept        join(32657..32779,32837..33645,33713..33813,33866..34072,
FT                   34128..34384)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977033"
FT                   /orf_name="Pc16g00140"
FT                   /product="Pc16g00140 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92684.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831DAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S3"
FT                   /transl_table=1
FT                   /translation="MAWFGYDQGVFSGVLISADFKKHFPQTKESNISGITSSCFSLGAF
FT                   FGAIFAFTLGDRLGRKKTITLGLVCNTIGAVLQIVSWHLPQLIVGRIINGFGMGLTSST
FT                   CPVYQAECSKPRVRGKLVVVGSLSNTAAFCLSNWMNYGLFFQGEALQWRFPLGFQLIFP
FT                   CIVVGALIFVPESPRWLLLQDRHEEALAVIARLEGRRKDVHDPDVTAQFLSIRSALEVE
FT                   RQSQVPMADVLMCRDKTQNLRRLLLSCGTQFMQQFSGVNALGYYLPTLLQESVGLAEEE
FT                   SRLLTAVNGTTYLFSAFCCLAIIDRFGRRKLMLYGSVTMGACYLIAAMCLKTGEGDPSR
FT                   KQQVVTTAMFFLYYFFYGTSFAKVPWVYNSEMNSLGWRTRGAAAATATNWMGGFIVTQF
FT                   TSVGVNTLHWRFYLIFAVIAWSFFPIIFCLYPETSRRTLEDMDEIFIRHPSPIVCGKQE
FT                   LTQRKRPQTFVDAERDRIMENKEFGKETAKGGTTAHYEHV"
     atggcatggt tcggctatga tcaaggtgtc ttctcaggag tcttaatctc agccgacttc        60
     aagaaacact tcccccagac gaaagagtca aacatctccg gcattacgtc gagttgtttc       120
     tctctcggag cctttttcgg cgctatcttt gcattcaccc tcggcgacag acttggccga       180
     aagaagacaa ttactctcgg cttggtgtgc aacaccattg gtgcagttct ccagattgtc       240
     tcatggcatt tgccgcagtt gatcgttggc cgtattatca atggctttgg tatggggctg       300
     acttcatcaa cgtgcccggt ttatcaagcc gagtgctcca aaccacgagt tcgtggaaag       360
     ctcgtggtag tcggttctct ctccaacacg gcagcctttt gtctatccaa ctggatgaac       420
     tatggtctat tttttcaagg cgaggcccta cagtggaggt tccctttagg atttcaactc       480
     atattcccat gcatcgtggt tggtgcactg atatttgttc ccgagtcccc gagatggctt       540
     cttctccaag atcgacacga ggaggcgctc gcggtgatcg caagactgga gggtagaagg       600
     aaggatgttc acgatccaga tgtgactgct caattcttat ctatccggtc agccctcgag       660
     gttgagcgtc aaagtcaggt accgatggcg gatgtcttga tgtgccgcga caagacacaa       720
     aacctccggc ggttgctctt gtcctgtggt actcagttca tgcagcaatt cagcggcgtg       780
     aatgcgcttg ggtattatct tccgactctc ttgcaggaaa gtgttggact cgcagaagag       840
     gagagtcgct tgctcactgc tgtcaatggc acaacgtatc tattctccgc attttgttgt       900
     ctggcaatta ttgatcgctt tggacgtcgc aagctaatgc tctatggctc ggtaactatg       960
     ggggcatgtt atcttattgc tgcaatgtgc cttaaaactg gcgagggcga tccttcacga      1020
     aaacaacagg tagtgacaac tgccatgttc tttttgtatt acttcttcta tggaacaagt      1080
     tttgccaaag tcccgtgggt ttacaactcc gagatgaact ctctgggctg gcgcactcga      1140
     ggtgctgccg cagccacagc aacaaattgg atgggcggat ttatcgtgac gcagttcact      1200
     agtgttggtg tcaatacctt acactggagg ttctatctga tcttcgctgt tattgcctgg      1260
     tccttttttc ctataatctt ctgcctctat ccggaaactt cacgacgtac cttggaggac      1320
     atggacgaga ttttcatccg acatccctcg ccgattgtgt gtggcaagca agagctgacc      1380
     caacgtaagc ggccacagac atttgtcgac gcagaaaggg atcgtattat ggagaacaaa      1440
     gaatttggaa aagaaacggc caaaggggga acgacagcgc actacgagca cgtataa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page