(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE15

PENCW_13.PE15        Location/Qualifiers
FT   CDS_pept        35978..37264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945510"
FT                   /orf_name="Pc16g00150"
FT                   /product="Pc16g00150 protein"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0001831DAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S4"
FT                   /transl_table=1
FT                   /translation="MVVELDTTLAELYANNGLPGPIVVDLYRTYTHIDLHDNFPRERMF
FT                   VEDEDPSTYCSEEEDLPRFKKWALNSRTIRHLPMVGPADVILYLPYNSRDNIDRALDQF
FT                   PKHQRPMVKYVDLDSPCMAKDRRMAIKDKKLVYWRPKSWMVGEDCSVPPELSYMLNDKR
FT                   FLIHPEIPTPSLEMVSLLHEDQRDYLVKLQLPFVVKFCRCSSGQGTYIATTEEERRQML
FT                   EAVRRYRERGGVDIQVSEFVGSRKPHYGVNFFVGRDESLQPCFLGATEQVVAKNGVWVG
FT                   GVIDYQAQGDLERRLRNTIAVVARTLQQYSYVGWIGIDVIFDSDDRPLVVDLNARIAAG
FT                   IGIVLFSKHFMSMGLPFAGMETVSFTGPASGIYAALSASIESGKVIVTLSAEVTDTESV
FT                   ASVVFGGRTRDDLNAVADWIRDVLRTCLN"
     atggttgtcg agttggacac taccctcgcg gaattgtatg caaacaatgg ccttccaggg        60
     ccgattgtcg tggacctcta tcgaacttac acccatattg atcttcatga caacttccca       120
     cgggaaagaa tgtttgtcga ggatgaggat ccatctacat actgttccga agaagaagac       180
     ctacctcgtt tcaaaaaatg ggccttgaat tccagaacaa tcaggcactt gcccatggtg       240
     ggccccgcgg acgtgattct ctatctgcct tacaattcaa gggacaatat cgaccgagcg       300
     ttggaccaat ttccaaagca ccagcgtccg atggtcaaat atgttgattt ggatagtcca       360
     tgtatggcaa aggaccggag gatggcgata aaagataaaa aattggttta ttggcggcct       420
     aaatcttgga tggtgggcga ggactgctca gtaccacccg aactctcata catgttgaat       480
     gataagcgat tcctcattca cccagagatc cccaccccat cactggagat ggtttcattg       540
     ctacacgaag atcagcgaga ttacttggtc aagcttcaac tgccttttgt ggttaaattc       600
     tgccggtgca gctcgggtca aggcacatat atcgcgacta ccgaggaaga aaggcggcaa       660
     atgctggaag ccgtccgccg atatcgtgag aggggaggag tagatatcca ggtatctgag       720
     ttcgttggct ccagaaaacc acactacggg gtgaacttct tcgttggtcg cgacgaaagt       780
     ctgcaaccat gttttctggg tgccacggag caggttgtcg ccaagaatgg cgtctgggtt       840
     ggtggggtca tcgattacca ggcacaaggg gacctcgaga gacgtctacg gaacacgatc       900
     gctgttgtgg cacgcacatt gcaacagtac tcatacgtgg gctggattgg catcgatgtt       960
     atctttgaca gtgatgaccg gcctttggtg gtggatctga atgctcgtat agctgcagga      1020
     attggaattg tccttttctc gaagcacttt atgtccatgg ggcttccttt tgctgggatg      1080
     gaaacggtat catttactgg accagcttca ggaatctacg ctgcgctatc tgcgagtatc      1140
     gagtctggaa aggtgattgt cactctgtca gcggaagtca cagataccga gtctgttgcc      1200
     tcggtggtct tcggcggtcg tacccgagat gatttgaatg cagtggcaga ttggattcgg      1260
     gacgtgctgc gaacttgcct caactaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page