(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE16

PENCW_13.PE16        Location/Qualifiers
FT   CDS_pept        join(complement(39295..39348),complement(39200..39244),
FT                   complement(39097..39144),complement(38137..39030),
FT                   complement(37998..38071),complement(37863..37944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977034"
FT                   /orf_name="Pc16g00160"
FT                   /product="Pc16g00160 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92686.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831DAE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5"
FT                   /transl_table=1
FT                   /translation="MATSLRNIIVVGGSFVGRTTAQELARIVPSTHRVLLTEPHSHFHH
FT                   LFTFPRFAIVPGQEHKAFIPYSGIFNASPNPSSHGVVQARVLSVKPTHIELDREWQGSK
FT                   DVPFDYVVVATGTRLSKPAAMDDDDKASSVEYLQKHQAGVKRSQSILIVGGGAVGVQMA
FT                   ADLKEYYPEKEVTVVQSRPRVMPNFHSGLHDLIKRRFDELGIRLITGSRVTIPPNGFPN
FT                   DGSTFDVQLTNGTTESTQFVILATGQTPNNQLVADLKSSRPDAESVVNPDNGFIRVRPT
FT                   MQFLDEQYSNLFAVGDIADTGAQKAARPGSAQAAVVAKNIQALIEGRAAEDTFAKGPGA
FT                   IHLTLGMKHNVIFRNPNTAEGQTEPWINPKDDGREDMNVEAMWERLGISVDNPRQYHL"
     atggcaacct cgcttcggaa tatcattgtc gttggcggct cgttcgtagg acgtacgaca        60
     gctcaggagc tcgcacgcat tgtgccttca acacatcggg ttctcttgac tgagcctcat       120
     agccacttcc accatctttt cacttttcct cggtttgcaa ttgttccggg tcaggaacac       180
     aaagcgttta ttccgtacag tgggatattc aatgcgtcgc ccaatccctc ctcccatgga       240
     gtagtccagg ctcgcgtttt gtcggtcaag cccacccaca ttgagctgga ccgcgaatgg       300
     cagggctcaa aagatgttcc ctttgactat gttgttgttg cgaccggcac ccgtctatcc       360
     aagcctgcgg ccatggacga tgatgataag gcatcatcag tcgaatatct gcaaaaacat       420
     caagccggag ttaagagatc tcagtcaatt ttgattgtcg gcggtggtgc ggtcggtgtc       480
     caaatggcgg ccgatttgaa agaatattat ccagagaagg aagtcaccgt ggttcaatcc       540
     aggccgcggg tgatgccaaa cttccactct ggactccatg accttattaa gaggcgattc       600
     gatgagctgg gaatcagact catcactggt tctcgagtca ccattccacc gaatggtttc       660
     cccaacgatg gcagcacctt tgatgttcag ctcacaaacg gcaccaccga gtccacacaa       720
     ttcgtcatct tggccaccgg tcaaacccca aataaccaat tggtggctga cttgaagtct       780
     tctcgcccgg atgccgagtc ggtcgtcaat cccgataatg gatttattcg cgttagaccc       840
     actatgcagt tcttggatga gcagtattcg aacctgtttg ctgtgggtga tattgcagac       900
     accggtgccc aaaaggcggc tcggccaggt tcagcacagg cagcggttgt tgcgaagaac       960
     atacaggcgt tgattgaagg ccgtgccgct gaagatacgt ttgctaaagg acctggcgcc      1020
     attcacttga cactcggcat gaaacacaat gtgattttcc gcaatcccaa taccgcagag      1080
     ggtcagacag agccttggat caacccaaag gatgatggcc gagaggatat gaatgtggaa      1140
     gctatgtggg aaaggctagg tatctcggtt gataatcctc gtcaatacca cctgtaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page