(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE164

PENCW_13.PE164       Location/Qualifiers
FT   CDS_pept        join(<385248..385297,385728..385747,385849..385857,
FT                   385934..385949,386088..386117,386210..386231,
FT                   386307..386313,386599..386640,386695..386761,
FT                   386819..386823,386890..386933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946607"
FT                   /orf_name="Pc16g01640"
FT                   /product="Putative uncharacterized protein Pc16g01640 "
FT                   /protein_id="CAP92834.1"
FT                   /db_xref="UniParc:UPI00018315D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H731"
FT                   /transl_table=1
FT                   /translation="TTTTTTTTVASLTLYLYSRYRVYNILDLRDRKLDFIVFSNYNLYR
FT                   SGVRFIGRKDVICVKQIKLRRGKSEIICDIFIIPLLSYYDTRSTGPRNPYRDYKDYSI"
     actactacca ctactactac cacggtcgct agccttactt tatacttata ctctagatat        60
     agagtttata atatattaga tttaagagat agaaaactag attttatagt ctttagtaat       120
     tataatctct atagatcggg ggttaggttt ataggaagga aagacgttat atgtgtgaag       180
     cagataaaat taagaagagg caaatctgag ataatctgtg atatctttat aataccttta       240
     ttatcttatt atgatactag gagtaccggc ccccgtaatc cttataggga ctataaggat       300
     tatagtatat ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page