(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE17

PENCW_13.PE17        Location/Qualifiers
FT   CDS_pept        complement(39905..40996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945511"
FT                   /orf_name="Pc16g00170"
FT                   /product="Pc16g00170 protein"
FT                   /protein_id="CAP92687.1"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI0001831DAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S7"
FT                   /transl_table=1
FT                   /translation="MPGHFGQKILNTLGLNDHIHHQSSSVRLPGRPALSNDERGLSSPP
FT                   NNGTYPRLCRLSDGTILSSFTRFPDGQRSLRVAKSTDNGRTFEDFSEVTRAAGDVDNMF
FT                   LCEVAPGTILAAFRNHDTGPNGPTHFRITVCRSTDGGRVWQYASQAAEKRPPLGIWEPF
FT                   MRVGRQGEVQLYFSQEFAHNNQCTMLVISRDQGSTWTQPTCLHGDQDPLRDGMCGIAPT
FT                   FDNGREALLMVFETTRYGPFSVEALLSYDDGATWGWRHEVYRPRQGHNAGSPQIASFAD
FT                   GSMATIFMTDEDSNRVEWVKNASIKVVFAGPPVEGRVQWSSPTLVSPASSFWPGIMALD
FT                   HHNVLATYDRGGPLTKTITWHPA"
     atgcctggac actttggcca aaagatactc aataccttag gtctcaacga tcatatccat        60
     caccagagct cctccgtccg acttccgggc cgaccagccc tgagcaacga tgaacgcgga       120
     ttatcttcac ctcccaacaa tggcacatac cctcgtctct gcaggctctc cgacggcact       180
     atcctctcgt cctttacccg attccccgat ggacaacgct cactccgcgt cgcaaaaagc       240
     accgataacg gccgcacgtt cgaagacttc tccgaggtaa cccgcgctgc tggcgacgtg       300
     gataacatgt ttttgtgtga ggtggctccg ggaacaatac tggcggcttt ccgcaatcac       360
     gacacgggtc cgaatggccc cacgcacttc cgcatcactg tctgccggtc tacggatgga       420
     ggccgggtct ggcagtatgc ttcgcaggca gccgagaagc gccctccttt gggcatttgg       480
     gaacccttca tgcgtgttgg acgccagggc gaagtgcagc tttatttctc gcaggaattc       540
     gcgcataaca accaatgtac catgctagtc atctcgcggg atcaagggag tacctggact       600
     cagccgacct gtctgcatgg tgaccaagat ccacttcgcg atggaatgtg cggcattgca       660
     ccaacttttg ataacggtcg cgaggctctt ctcatggtat tcgagaccac ccgatacgga       720
     ccgttcagtg ttgaagcgct tctatcctac gatgacggcg cgacctgggg ttggcgccat       780
     gaagtttacc gcccacgaca gggtcataat gcaggctctc cccagattgc ttcttttgcg       840
     gatggatcca tggctacgat attcatgacc gacgaagact ccaaccgcgt ggaatgggta       900
     aagaatgcct cgatcaaggt cgtattcgct ggcccaccag tcgaagggcg cgttcaatgg       960
     agctctccaa cccttgtatc cccagcctcc agcttctggc ctggaattat ggcattggat      1020
     caccacaacg tgctagccac ttatgatcgg ggtggaccgc ttacgaagac catcacctgg      1080
     caccctgcgt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page