(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE170

PENCW_13.PE170       Location/Qualifiers
FT   CDS_pept        join(400190..400420,400492..401394)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977309"
FT                   /orf_name="Pc16g01700"
FT                   /product="Pc16g01700 protein"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAP92840.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00018315D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H727"
FT                   /transl_table=1
FT                   /translation="MSFSNLVSDIAFRDARVDDGSSQISHARSHRSHATARSYASTAAT
FT                   SVSISGEVSSQLHSGYSHPLTRAWQADRQLTKDMLIYPLFITDNPDEETSIPSLPNQYR
FT                   RGINRLVPFLAPLVRKGLRSVMLFGVPLQPSAKDALGTAADDPDGPVIQAIRLLRSRFP
FT                   QLYITTDVCLCEYTSHGHCGILREDGSLDNAQSVDRISDVAIAYAAAGAHCVAPSDMND
FT                   GRIRAIKLKLIEAGMAHRVLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGR
FT                   GLARRAIQRDMAEGADIIMVKPASSYLDIIRDAKDLAPDLPVAAYQVSGEFAMIHAAAK
FT                   AGVFNLKDMAFESTEGILRAGAGIVISYFVPEFLDWL"
     atgtccttct caaatttggt ctccgacatt gcctttcgtg atgcccgtgt ggatgatggc        60
     agctcgcaaa tctctcacgc ccgatctcac cggtctcatg cgaccgctcg gtcgtacgcc       120
     agcaccgcag ccacaagcgt cagcatttct ggcgaagttt ccagccagct acactccgga       180
     tacagtcatc ccctgaccag agcatggcag gctgataggc aattgacaaa ggatatgctc       240
     atatatccat tgtttatcac agacaacccg gacgaggaga catcaattcc ctcgttgccg       300
     aatcaatacc gccgtggaat taatcgcctg gttcctttcc ttgcccccct tgttcggaag       360
     gggctgcgct cagtaatgct atttggtgtc ccgcttcaac cgtccgccaa agatgcactt       420
     ggaaccgccg cagatgaccc agatggtcct gtaattcaag cgattcgtct tctccggtct       480
     cgtttccctc aactttatat cacaaccgat gtatgtctct gcgagtatac ttcgcacggc       540
     cactgtggta tcttacgaga agatggatct cttgacaatg cgcaatccgt tgaccggatc       600
     tccgatgtag ctattgccta cgcggcggct ggagctcact gcgtggcccc gtcagacatg       660
     aacgacggaa ggatccgggc tatcaagctc aagttgattg aagctggtat ggcacaccgt       720
     gtacttttga tgtcttacag tgccaaattc agcggctgct tatatggacc gttccgtgat       780
     gcggctggct cctgtccctc attcggggat cgtcggtgct accagcttcc cccaggcggc       840
     cgcggtcttg cccgacgtgc gatacagaga gatatggccg aaggtgcaga tattatcatg       900
     gtcaagccag ctagcagcta ccttgatatc atccgggatg ccaaggattt ggcaccggat       960
     cttccagtgg ccgcctacca agtcagtggt gaatttgcaa tgatccatgc cgctgccaag      1020
     gccggtgtct tcaatctcaa ggatatggcc ttcgaaagca ccgaaggcat attgagagca      1080
     ggcgctggga ttgtgatcag ttatttcgtc ccagaattcc tcgactggct ttag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page