(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE171

PENCW_13.PE171       Location/Qualifiers
FT   CDS_pept        join(complement(403601..404396),complement(402172..403418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824072"
FT                   /orf_name="Pc16g01710"
FT                   /product="Pc16g01710 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92841.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI00018315DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H728"
FT                   /transl_table=1
FT                   /translation="MTALAAGPVMNGGHDSGAETGTEHSPSRFTAVNGREPVNPGNTNG
FT                   KGNGPTPSSIPNGEHVPAQEKTNSDATQRDDRDDPANDQEKWSQRSSPSGSHNKNKRKR
FT                   SESRERDSVNASRSPVTRPMDSNQPNPNGSIPGSVSEMERGNHSATPSQRSEGNDAGQT
FT                   SANSPWSEYDSQLITQAQRAQQMDASDAHLADALQREAGQEKSITNRSTPGPQHPSSPG
FT                   YAPDRHGTMQVAPKRKRVFSNRTKTGCMTCRRRKKKCDEQHPACNNCIRGGFLCEGYSS
FT                   RSTWQKPSSTKTPIPLQSKEGYSDINGPYMQETSRPQDRQPGLVEHVDAAKIRPLVEEN
FT                   DRPVQQYSTSPTHTPSNHAWSKQAWPGAGPGATSNTGHPPYPSEPIAKVVDYREVPPIH
FT                   ELSREGRPKPDYPVISSLRDLSHPSHPKSSMPLFQNGPEQRTLPAAAVDTHSPQAQARM
FT                   ALSIEHQLSGRTVSSDETEKEKMIRGKLYRPFDVHLVEERDRCRGALWKFNNACNPLNG
FT                   ISSKEQNRLLKEVIVPPACSIVNSPAGTGVPRSVGSIGQGAVVEAPFSCHYGYNIHLGE
FT                   DVMISENCLFVDDCVIRIGAHTWIGPNVKIISSTAHPNMQERKGSQSRYQGRQVIIEED
FT                   CYVGAGCIIYPGVRLARGVYVAPGEIVNTNIAGYMFQGSKPSFAM"
     atgacggctc ttgctgctgg acccgtcatg aatggtggtc acgattctgg ggccgaaaca        60
     gggacggagc acagcccatc ccgatttact gcagttaatg ggagagaacc tgtgaaccct       120
     ggcaatacca atgggaaagg gaatgggcca acacccagtt ccatccccaa tggagaacat       180
     gtgccagccc aggaaaagac caactcagat gccactcaac gagatgaccg ggatgatcct       240
     gccaatgatc aagagaagtg gtcacaaaga tcctcgccca gcggctctca caataagaat       300
     aagagaaaga gatcagaatc ccgagaacga gattctgtga acgcttccag gagcccggtg       360
     acccgtccta tggacagcaa ccaacccaat ccgaatggca gtataccagg atcggtctcg       420
     gagatggagc gtggcaatca ttctgcaaca ccgtcgcaac ggtctgaggg caatgatgcg       480
     ggccagactt ctgctaatag tccttggtca gaatatgatt ctcagctgat cactcaagca       540
     caacgggccc agcaaatgga tgcatcggat gcccacctag cagacgctct tcaacgcgag       600
     gcaggccaag aaaagtccat aacaaatcgc tcgacccccg gccctcaaca cccatcctct       660
     cctggttatg cgccagaccg acatgggaca atgcaggtgg ctccaaagag aaagcgggta       720
     tttagtaacc gaacgaagac aggttgtatg acctgccgcc gcagaaaaaa gaaatgcgac       780
     gagcaacatc cggcatgcaa caactgtatt cgtggaggct tcttatgtga agggtattca       840
     tcccgaagca cctggcaaaa gccatctagc acgaaaactc cgatcccttt gcaatccaaa       900
     gaaggctatt cagacatcaa tggcccgtat atgcaagaaa catcacgacc tcaagaccga       960
     cagcctggct tagtggagca tgtcgacgcg gcaaaaatca ggcccctggt ggaggagaat      1020
     gaccgccctg tgcaacaata cagcaccagc ccaacacata caccatccaa ccatgcgtgg      1080
     tcaaaacaag cttggccagg tgctgggcca ggcgccacgt ctaatactgg tcatcccccc      1140
     tatccatccg aacctatagc gaaagtcgtc gattatcggg aggtcccacc aatccatgag      1200
     ctgtcgcggg aaggacgtcc caaacctgac tacccggtca tctcttctct tcgggacctt      1260
     agtcatccgt ctcatcctaa atccagtatg cccttgttcc aaaatgggcc cgagcaacga      1320
     acgttgcccg cggcggctgt ggatacccat agtccccagg cgcaggctcg aatggcgctc      1380
     agtatcgaac atcagctctc tggccgtacc gtgtcgagtg acgagacgga gaaggaaaag      1440
     atgatcaggg gcaagctcta ccgaccattt gacgtgcacc tcgtagagga aagggatcgc      1500
     tgccgaggtg ctctgtggaa atttaacaac gcctgcaatc cgctcaatgg catcagttcg      1560
     aaagagcaaa accgcctcct gaaggaggtc atcgtacccc cggcatgttc cattgtcaat      1620
     tcaccagctg gaaccggcgt gcctcgctct gtcggatcca tcggccaagg ggcggtcgtc      1680
     gaggccccct ttagttgcca ctatggttat aatatccacc tcggcgagga cgtcatgatc      1740
     tcggaaaatt gcctgtttgt ggatgactgt gttatccgca tcggtgctca tacatggata      1800
     ggccccaacg tcaaaataat tagttcaacc gctcatccca acatgcaaga gcgcaaagga      1860
     tcgcaaagtc ggtatcaagg tcgtcaggtc atcattgaag aagattgtta tgtgggcgcg      1920
     gggtgtatca tctacccagg ggttcgtctt gctcgtgggg tttatgtggc cccgggagag      1980
     atcgtcaaca cgaacattgc aggttacatg tttcagggat caaaacccag ctttgctatg      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page