(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE173

PENCW_13.PE173       Location/Qualifiers
FT   CDS_pept        join(410824..411037,411113..411435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946609"
FT                   /orf_name="Pc16g01730"
FT                   /product="Pc16g01730 protein"
FT                   /protein_id="CAP92843.1"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniParc:UPI00018315DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H730"
FT                   /transl_table=1
FT                   /translation="MSRTRQPMGSNLFQTTTESPQDSSTAHIPPTLRLRAEEAPTDASE
FT                   ATSSSRRIRWSEDVVDNEGMGKKSSKVCCIYHKARPVGESSSEESSSSSSESDSESEDD
FT                   RRTARVNRARHTHSHNGGREPHSEHASQPDEGCCPEDHGSKPKRNRRKPSPNAYEKMPK
FT                   PSKNPKQNQNHARGT"
     atgtctcgaa cacgccagcc gatggggtca aatctgttcc aaaccaccac agagtcccca        60
     caagactcct caactgccca cattccccca accctcagat tacgagctga ggaagcacct       120
     actgatgcca gcgaagcaac atcgtcttct cggcgaatca gatggagtga agatgttgta       180
     gacaacgagg gcatgggaaa aaagagttca aaagtatgct gcatctacca caaagctcgg       240
     ccagtgggag aaagtagctc agaagagtct tcatccagct catctgagag tgatagcgag       300
     agtgaagacg accgtcgcac cgccagagtc aaccgggctc gccacacaca ctcacacaac       360
     ggagggcggg aaccccacag cgagcacgcg tcccaaccgg acgaagggtg ttgccccgaa       420
     gaccacggct ctaaaccgaa acgcaatcgc aggaagccaa gtccgaatgc atatgagaag       480
     atgcctaagc cgtcgaagaa tccgaagcag aaccaaaatc atgcgcgggg tacttga          537
//

If you have problems or comments...

PBIL Back to PBIL home page