(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE174

PENCW_13.PE174       Location/Qualifiers
FT   CDS_pept        join(complement(414054..414102),complement(413565..413976),
FT                   complement(412973..413511),complement(411987..412912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946610"
FT                   /orf_name="Pc16g01740"
FT                   /product="Pc16g01740 protein"
FT                   /biological_process="meiotic chromosome segregation "
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92844.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045132"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="UniParc:UPI00018315DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H752"
FT                   /transl_table=1
FT                   /translation="MARLNDYAAPAESIDALKRRFVRQNREIARVNSLQSLRIRSLESE
FT                   VSHLLSENVSLRKQVINLTQETERLEAGKMLHNGIYDIKSKLDAKLAELSNLAADLGSL
FT                   PRKVGKLCDDQLDRPKQAESRPRTEDIVGGEDGRLPAIVEDKYYPRRTLEPQELDSLVH
FT                   DDHSILDSPPQFSFMPEEGDAPIEHSSPSPPESKFRSQIENDTPEEPEPLLPPTLETRR
FT                   KKKKSGSIVAPEISPAQTDRPPSPPVDTTQHAKPVSTKRKYIPEDDDRFASNLIGDGDD
FT                   DEFQFTRPSHSPKKRTTPFEDTQRDQLLTESHVEVTRGSKTPVLSMRKVLEPKSANSNL
FT                   GSPKKARMSSYQDSKLLQMSTKGDENNNSPQKVKDVEKIGGKTVNQKPRVSRIAPSNKE
FT                   KRAIHPVPPQLEEPTPHQPAMPLHPNAMKTEEESAVRPSRRRGAVVSYAEPNLRDKMRR
FT                   PTKEMIDAVALGSRRSSSFQASQENVDGGGEGGHTQPHSSLPDDSTLAQSSDLFSADGS
FT                   SEQLAMVSRRKRKVSANPKDDNDAGNPSSALKNEIEDSLADISAQVSQKPLNSRRQTRR
FT                   HSSNPRSTTANIAQYGVDQVDLQSPTGDSPEDEDSFGPGPNSSTMDTNDVRRGQRAAAR
FT                   RKSMMV"
     atggctcggt tgaatgacta tgcggctcct gccgagtcca ttgatgcttt gaagcgacga        60
     tttgtgcgac aaaaccgtga gatcgcaagg gtgaactcct tgcaatctct tcgtattcgc       120
     agcctagagt cagaagtatc gcatctactt tcggagaatg tgtcgcttcg caaacaggtc       180
     atcaatctca cacaggaaac cgaaagattg gaagcaggga aaatgctgca caatggaata       240
     tacgacatca aatccaagct agatgccaaa ctagccgagt tgagcaattt ggcggcagat       300
     ttgggttcat tgccccgcaa ggtgggaaag ctctgcgacg atcagctcga taggccaaag       360
     caggcggagt ccagacctag gacagaagac atagtgggag gcgaagatgg aaggcttcct       420
     gccattgttg aggacaaata ttatccccgg cggactctgg agccccagga gctcgacagc       480
     ctggtccatg acgatcacag catcctagat tctccgccac agttcagctt tatgccggag       540
     gaaggggatg cacctatcga acattcaagt ccatcgccac cagaatcgaa attcaggagc       600
     caaatagaaa atgatacccc cgaagaacca gagccgttac ttcctccaac cctcgagaca       660
     cgcaggaaga aaaagaagtc aggttcgatt gttgcgccag aaattagccc cgcgcaaaca       720
     gatcggccgc caagtccacc tgtcgacact actcagcatg caaaaccggt ttcaacaaag       780
     cgcaaataca tacccgaaga cgatgacaga ttcgcatcca accttattgg cgacggcgac       840
     gacgacgaat tccaattcac ccggcccagt cacagcccca aaaagcgaac aacaccattc       900
     gaagatacac agcgagacca attactcact gaaagccacg tcgaggtgac aagaggttca       960
     aaaaccccgg tcctgtctat gcggaaggtc ctcgagccaa agagtgcaaa ttccaatcta      1020
     ggatctccca agaaggcccg catgtcttcg taccaggact ctaagcttct gcaaatgtcc      1080
     actaagggtg acgagaataa caactcgccc cagaaagtga aggatgtcga gaaaatcggt      1140
     ggcaagactg tcaatcaaaa gccgcgtgtt tccagaatcg ccccttcaaa caaagaaaag      1200
     cgcgccattc accctgtccc tccccagcta gaagagccaa cgccacacca gccagcaatg      1260
     ccactacatc cgaatgcaat gaagacggag gaagagtctg cagttcggcc ttcccggcgt      1320
     cgtggtgctg tagttagcta tgcagagcct aacctccggg acaagatgcg ccgccctacc      1380
     aaggaaatga tcgatgctgt tgcacttgga tcgcgaaggt cctctagttt ccaggcaagt      1440
     caagaaaacg tggacggtgg aggagagggt ggccacactc agcctcatag cagcctcccg      1500
     gatgattcca ctctggcgca gagctcagat ctgttctccg cagacggatc ttcagaacag      1560
     ctggcaatgg tctcacggag aaaacgcaag gtgtcagcga acccaaagga cgacaacgat      1620
     gcggggaatc caagttctgc cctcaagaat gagattgagg acagcctcgc agatatctcg      1680
     gcccaagtgt ctcaaaagcc attaaattca aggcgtcaga ctcgacgtca ctcgtcaaac      1740
     cccaggagta caactgcaaa tatagcacaa tacggcgtgg accaggttga cctgcaatcc      1800
     ccaactggcg actctccaga agacgaggac tcatttggac cgggaccaaa tagttcgaca      1860
     atggacacca atgacgtcag acgtgggcag cgtgctgctg caaggagaaa aagcatgatg      1920
     gtatga                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page