(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE177

PENCW_13.PE177       Location/Qualifiers
FT   CDS_pept        join(complement(418815..419183),complement(417960..418717),
FT                   complement(417774..417892),complement(417399..417706))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671368"
FT                   /orf_name="Pc16g01770"
FT                   /product="Pc16g01770 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92847.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00018316CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H755"
FT                   /transl_table=1
FT                   /translation="MAIAAALASLQGSVIEYPYHSLAAAAVLAPILYVILNEFIRDAAR
FT                   VKGMKGPRGLPLIGNLAQIRKDAAEQYRLWSKKHGAVYQIQLGNIPVVVVNSAASAKVL
FT                   FGQNAQALSSRPETYTFHKIVSNTAGTTIGTSPYSDSLKRRRKGAASALNRPSVDTYVS
FT                   HLDVESKAFVEELYRYGNHGKTPVDPMAMIQRLSLSLALTLNWGVRIASQEEELFDEIT
FT                   EVEEEISRFRSTTGNLQDYIPLLRLNPFSSNSKKAAEMRRRRDKYLGALNSDLDDRMAK
FT                   GTHKPCIQANVIMDKEAKLNSEELTSISLTMLSGGLDTVTTLVAWSLGLLAQRPDIQDR
FT                   AAKAIQEMYGEDDPMCSPDDDQRCAYIAALVKECLRFFTVLRLALPRTSIKDITYKGIT
FT                   IPKGTVFFLNAWACNMDPDVWTDPDDFRPERWLEQPDAPLFTYGMGYRMCAGSLLANRE
FT                   LYLVFIRTLNSFRLEPHDKTDCHPLRGNSDPTSLVAIPQKYKVRFVPKNEKALSKVLAQ
FT                   "
     atggctatcg ccgctgccct ggcgtcgcta caaggcagtg tgatcgagta tccctaccac        60
     tcactagccg ccgcagccgt cctcgccccc atcctctatg tcatccttaa tgagttcatt       120
     cgtgatgccg cccgcgtcaa gggtatgaag ggtccgcgcg gattgccgtt gattggaaac       180
     ctggcccaga ttcgcaaaga tgccgcggag cagtatcgcc tctggtcgaa aaagcacggc       240
     gctgtgtatc agattcagct ggggaacatc cccgtcgttg tggtcaactc tgctgcgtcg       300
     gcaaaagtgc ttttcggtca gaatgcgcag gctttgagct ctaggcccga aacttatact       360
     ttccataaga ttgtttccaa tactgccgga acaactatcg gcacctcgcc atatagcgac       420
     tctctgaaga gacgcagaaa gggcgccgcg tcggctctca accggccctc tgtcgatacg       480
     tacgtgtcac atttggacgt cgagtcaaag gccttcgtgg aagagctgta cagatatgga       540
     aaccacggga agacacccgt cgatcccatg gccatgatcc agcgtctgag tttgagtttg       600
     gcattgactc tgaactgggg cgtgcgtatc gcttcacagg aagaggaatt gttcgatgag       660
     atcaccgagg tggaggaaga gatcagtcgg ttccgaagca ccaccggaaa cctgcaggat       720
     tatatccctc ttctgcggtt gaacccgttt agctccaact cgaagaaagc cgccgagatg       780
     agaaggcgtc gggacaagta cctcggtgcg cttaatagtg acttggatga tcgcatggca       840
     aaggggacac ataagccttg tattcaggcc aacgttatta tggataagga agctaagctg       900
     aacagtgagg agttgacgtc gattagcttg accatgcttt ctggtggcct tgacactgtc       960
     accactttgg ttgcgtggag tttgggtttg ctggctcaac gtcctgatat tcaggatcgg      1020
     gcggccaagg ctatccagga gatgtatggc gaggatgatc ccatgtgctc tcctgacgat      1080
     gatcagaggt gtgcgtacat tgcagctctg gtcaaggaat gtcttcgatt cttcactgta      1140
     ctgcgattag cacttcctcg cacttcaatc aaagatatca cctataaggg aatcaccatt      1200
     cccaagggca cagtgttctt tttgaatgcc tgggcctgca acatggaccc cgacgtgtgg      1260
     actgacccgg atgacttccg tcccgagcga tggctcgagc agcccgacgc gcctctcttt      1320
     acgtatggta tgggttaccg gatgtgcgcc gggtcactgc tagccaatcg tgagctctac      1380
     ctggtcttca tccgcaccct caacagcttc cgcctcgaac ctcatgacaa aacagactgt      1440
     caccctctcc ggggtaactc ggatccgact agtctggtgg ccattcctca aaaatataag      1500
     gtccgatttg tgccgaagaa tgaaaaggct ctgtcgaagg ttcttgcgca gtga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page