(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE178

PENCW_13.PE178       Location/Qualifiers
FT   CDS_pept        join(419310..419405,419836..419928,420018..420149,
FT                   420333..420410)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946611"
FT                   /orf_name="Pc16g01780"
FT                   /product="Putative uncharacterized protein Pc16g01780 "
FT                   /protein_id="CAP92848.1"
FT                   /db_xref="UniParc:UPI00018316CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H756"
FT                   /transl_table=1
FT                   /translation="MEHFRVVKVVQPAMASLGVLLPHTTPGLARSQGLVKIISTCARTQ
FT                   DLLERRASFGKRFPKSGKFEGTRKQVDPKLFINGSPWSPVGPGWGKIAVPDWSIGQMEL
FT                   DSQKVESWKGEVGSSGRDNEISSRHVSE"
     atggaacatt tccgtgttgt caaggtcgtt caacccgcga tggcctctct cggtgtcctt        60
     ttaccccaca ctaccccagg tcttgccagg tctcaggggc tagtgaagat catatccact       120
     tgcgcaagga ctcaagacct tctagaaaga agagcctcat tcggcaaaag gtttcccaaa       180
     tctgggaagt tcgaagggac tcgcaagcag gtcgatccaa agctgttcat caacgggtcc       240
     ccctggtctc ccgtgggccc cggatggggc aagatagcag tccctgactg gtcaattggt       300
     caaatggagc ttgacagtca gaaagttgag agctggaaag gggaagttgg aagctctgga       360
     agggataacg aaatttcttc acgtcatgtg tcggagtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page