(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE179

PENCW_13.PE179       Location/Qualifiers
FT   CDS_pept        join(420963..421393,421529..421788,421844..423172,
FT                   423235..423320)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946612"
FT                   /orf_name="Pc16g01790"
FT                   /product="Pc16g01790 protein"
FT                   /function="glycerol-3-phosphate dehydrogenase activity "
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAP92849.1"
FT                   /db_xref="GO:0004368"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00018316CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H757"
FT                   /transl_table=1
FT                   /translation="MAARHSRKLLRPLLYTSAAAAAGAGVLYISYRPRNIPGLEAPAVP
FT                   PPGYREGKLVPPSFPSIKSRLDQIQDLKRSNDEEEYDLLIIGAGATGAGIALDAATRGL
FT                   KVAVVERDDFSSGTSSKSTKLVHGGVRYLEKAVWELDYNQYALVKEALRERKYFLNTAP
FT                   HLSSWLPIMVPVQKWWQAPYFWAGTKAYDFLAGSEGIETSYFLTKSKAIDAFPMLKRDD
FT                   IIGAMVYYDGAHNDSRMNVSLAMTAALYGTTVVNHLEVTGLNKDASGKLCGARAKDLVT
FT                   EKNGEVAQEFNIRAKGVINATGPFSDSIRKMDEPDVKEIVAPSAGVHIILPGYFSPSNM
FT                   GLIDPSTSDGRVIFFLPWQGNTIAGTTDQPCEIEAQPQPTEKDINWILSEIRGYIAPDI
FT                   TVDRSDVLAAWSGIRPLVRDPKVKNSEALVRNHLVTVSQSGLLTCAGGKWTTYRQMAEE
FT                   AVDEAINVFKLKPRQLSTLPDISGVGGSGLVADGAVLDGSCQTHQVRLIGAHGFSKTLF
FT                   INLIQHFGLETDVAKHLTESYGDRSWQVAALSSPTSERFPVRGCRISPMYPFIDGEVRY
FT                   AVRHEYAQTAVDVIARRTRLAFLNAEAALESLPTVIDLMGEELEWSTARKDLEWKDSLT
FT                   FLSSMGLPKSFMGLSRRDVQNGRVKQVDDAERATFSRNEPPADMIESDKRATTAAPAAP
FT                   AATPSLN"
     atggctgccc ggcactcgcg caagctcttg agacctctcc tctacacatc cgcagccgct        60
     gccgcaggag caggtgttct ctacatttct tatcgtccgc gaaatattcc gggcctcgaa       120
     gccccggccg ttcctccgcc aggttaccgt gaaggcaagc tggttccgcc cagtttccct       180
     tcaatcaagt ctcgcctcga tcagattcag gaccttaagc gcagtaacga cgaggaggaa       240
     tatgacctgc tcatcattgg tgctggagcc actggagctg gtatcgcact agatgccgcc       300
     acccgaggcc tgaaggtcgc ggtggtggag agagatgact tcagttcggg tactagtagt       360
     aagagtacca aactggtaca cggtggtgtc cgttaccttg aaaaggctgt gtgggaattg       420
     gactacaatc agtatgcgct agtcaaggag gctctcaggg agcgcaagta tttcttgaac       480
     acagctcccc atctgtcatc atggctgcca attatggtgc ctgttcagaa atggtggcag       540
     gctccctatt tctgggccgg caccaaggcc tatgacttct tggctggttc cgagggcatt       600
     gagacctcat acttcctaac caagagtaag gccattgacg cgttccccat gctgaagcgt       660
     gatgacatca ttggagcaat ggtctactat gatggtgcgc acaatgactc ccgcatgaac       720
     gtctctctcg ccatgaccgc tgcgctctac ggtaccaccg tggtgaacca cctggaggtc       780
     actggactga acaaggatgc atccggcaag ctgtgcggtg cgcgcgccaa ggacctcgtc       840
     acagagaaga acggcgaggt cgcccaggag ttcaacattc gtgccaaggg tgtcatcaac       900
     gccactggtc ccttctctga ttccatccgc aagatggacg agcccgatgt caaggagatt       960
     gtggccccca gtgctggtgt ccacatcatc ctgcctggtt acttcagccc ctcaaacatg      1020
     ggtctaattg acccttccac atcggatgga cgtgtgatct tcttcctgcc gtggcagggt      1080
     aacaccatcg ctggtaccac ggaccagccc tgtgagatcg aggcccaacc ccagcccact      1140
     gagaaggaca tcaactggat tctttcggag attcgtggct acatcgctcc ggatatcacc      1200
     gtggaccgaa gcgacgtcct ggctgcttgg tctggtatcc gtcccttggt gcgcgatccc      1260
     aaggtgaaga actcggaggc tctcgtccga aaccacctgg tgaccgtctc tcagtctgga      1320
     ctgttgactt gcgccggtgg taagtggacc acttatcgcc agatggccga ggaggccgtg      1380
     gacgaggcga tcaacgtgtt caagctcaag ccccgccagc tcagcaccct tcccgacatc      1440
     agtggtgtcg gtggcagtgg cctggttgct gacggtgccg ttctcgacgg tagctgccag      1500
     actcaccagg tgcgcctcat cggtgcccac ggtttctcca agaccctgtt catcaacctt      1560
     atccagcact tcggcctcga gaccgacgtg gccaagcacc ttaccgagtc gtacggtgac      1620
     cgctcatggc aggtcgctgc cttgtcttcc cctaccagcg aacgtttccc tgtgcgtggc      1680
     tgccgcatct cccccatgta tcctttcatt gatggcgagg tccgctacgc cgttcgtcac      1740
     gagtatgccc aaaccgccgt cgatgtgatt gcccgtcgca cccgtctggc tttcctgaat      1800
     gccgaggccg ctctcgaatc cctccccacc gtgattgacc tgatgggtga ggaattggag      1860
     tggagcactg cccgcaagga ccttgagtgg aaagattcct tgacattcct ttcgtccatg      1920
     ggtctgccca agagcttcat gggcctttcg cgtcgtgatg tccagaatgg ccgtgttaag      1980
     caggtcgatg atgccgagcg tgcgactttc tctcgtaacg aacctcccgc ggatatgatt      2040
     gagagtgaca agcgtgctac tactgcagct cctgcagctc ctgcagcaac gccctcgctc      2100
     aattag                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page