(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE18

PENCW_13.PE18        Location/Qualifiers
FT   CDS_pept        complement(42245..43294)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945512"
FT                   /orf_name="Pc16g00180"
FT                   /product="Pc16g00180 protein"
FT                   /protein_id="CAP92688.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI0001831DB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9"
FT                   /transl_table=1
FT                   /translation="MHFHSTLLSGLAILPVALASWPFFEHTAKLSATPYRNERPNVKVE
FT                   TLFQFPNNGSWIDNMVIRSDGNLLLTRLDTPEVWLFDTTTGNATLAYSFPNVTSCFGIS
FT                   EIDDDVFAVVVGNFSAKTFQPGPASFSVQKLDFTKSDSEENARALGSPTASEIVAMPDA
FT                   GALNGMATLSRGSNLVLIADSPKGVIWKVDTKTGDYSVALNDTTMAPAKGQGLPLGVNA
FT                   LTVLGDYVYYTGTTQMVYCRVKVDKEANPVGDFEVIASGFLPDNVEMTEDGVAYIPTAP
FT                   QNSVVRLTPSGQISLVTGGQVSTQLAGPSSVRLSKDRQILYVGTNGGQIAPVLGSFIEP
FT                   AKIVKVSFE"
     atgcacttcc acagcacctt gctcagcggc ctagctatcc ttccagtggc tctagcttcc        60
     tggcctttct tcgaacacac tgcaaagtta tcggcaaccc cctaccgcaa cgagaggccc       120
     aatgtgaagg tcgagaccct cttccaattt cccaacaatg gctcatggat cgacaatatg       180
     gtcatccgat cagacggcaa ccttcttttg acgcgtctgg atacccccga agtttggctt       240
     ttcgacacca caaccggaaa cgcgaccctt gcctactcct tcccgaacgt caccagctgc       300
     ttcggaatca gtgaaatcga cgacgacgtc ttcgcagttg ttgtgggcaa tttctctgcc       360
     aaaaccttcc agccaggtcc agcctcgttc tcggtccaga agttggattt caccaagagc       420
     gattctgagg agaatgcgcg tgcgctggga tcaccaacgg cttcggagat cgtcgcaatg       480
     ccagatgctg gggccttgaa tggcatggcc actctgtcgc ggggttcgaa tttggttctc       540
     attgccgata gccccaaggg ggtgatatgg aaggtcgata ccaagacagg agactattct       600
     gtcgcgctga atgatactac aatggctccg gcgaaggggc agggtcttcc tctgggtgtc       660
     aatgccctga cagtacttgg tgactatgtt tactataccg gcacgacaca aatggtgtat       720
     tgtagggtca aggtggacaa ggaggccaac cctgtcggag atttcgaggt tattgccagt       780
     gggttcctac cagataacgt cgagatgacc gaggatggcg ttgcgtatat tccgacggct       840
     cctcagaact cggttgtgcg cctcacacct tcgggccaga tctcactcgt tacaggcggt       900
     caagtatcta cccagctggc aggtccaagc tcagttcgat tgagcaaaga ccggcaaata       960
     ctctatgttg gcaccaacgg tggtcaaatt gcgcctgttt tgggctcatt catcgagccc      1020
     gcaaagattg tcaaggtatc gtttgagtaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page