(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE180

PENCW_13.PE180       Location/Qualifiers
FT   CDS_pept        join(423636..423799,423850..423863,423915..423987,
FT                   424041..424734,424791..424988,425052..425216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946613"
FT                   /orf_name="Pc16g01800"
FT                   /product="Pc16g01800 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92850.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00018316CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H758"
FT                   /transl_table=1
FT                   /translation="MNPNQCEIDSQPLSFVKQKLDPDKESVLPKPELEEQDPFGDESQA
FT                   GVKYKTMAWWQAGMIMIAETISLGILALPKALAVLGLIPGILTILGVGTISTYTAYTIG
FT                   QFKCRHVRVHSMADAGDILMGKIGRSTLDVAQLVFFVLVMGSHVLTFSIMMNVLTEHSS
FT                   CTIIFSVVGLLASFMLTLPRRLERLSHISSVSFVSIVGAVLTGMIGVTLVKEGPVHVSA
FT                   FSPSPKVHDACLAIANIIFAYAGHVAFFTLFSELRELRDFPKALALLQMSEMVLYTVAA
FT                   IVIYAYIGPTVNSPALNSAGQLFRKISYAIAIPTIVIGGVVNAHVAVKFIYVRVFRGTN
FT                   SMHSRSFLARLLWAAICAALWILSWIIAEGIPVFNDVLGLASSLFASWFSFGLPGLFWL
FT                   YLNRSCWFLTWRQRVLFGFNIFLVFLGFVIVSCVPL"
     atgaacccca atcagtgtga gatcgattcc caaccgctga gctttgtgaa gcaaaagctg        60
     gatccggata aagagtccgt cttaccaaag ccagagttgg aggaacagga tcccttcgga       120
     gatgaaagcc aagctggcgt gaagtacaag accatggcgt ggtggcaagc cggtatgatc       180
     atgatcgcag aaaccatctc gcttggtatc ctcgcgctgc ccaaagcgct tgcagtgcta       240
     ggtcttattc ccggcatcct aaccatcctt ggggtcggga caatctcgac gtatactgcg       300
     tatactattg gacaattcaa atgccgccat gttcgagtgc acagcatggc tgatgctggg       360
     gatattttga tgggaaagat cggacggagt acactggacg tggcccagct cgtctttttc       420
     gtgttggtga tggggagcca tgtcctcact ttttcgatca tgatgaacgt cctcactgag       480
     cattcctctt gcaccatcat attttcggtt gtcggtttac tcgcctcgtt tatgttgacc       540
     cttccacggc gacttgagag gctttctcac atctcctccg tgagtttcgt gagtatcgtc       600
     ggagctgttc tcacaggtat gattggggtc acccttgtca aagaagggcc agtgcatgtc       660
     tcggcctttt cgccttcgcc caaagtgcat gatgcgtgcc ttgctattgc aaatatcatc       720
     ttcgcgtacg caggacatgt tgctttcttt acccttttct ctgagctcag agagctcagg       780
     gacttcccga aggccctggc acttctgcag atgagtgaaa tggtcttata tacggtggct       840
     gccattgtga tatatgccta tattgggccg actgtcaact cgcccgctct caattctgct       900
     ggacaattgt ttcgcaagat ttcctacgca atcgcaatac ctacgattgt gatcgggggc       960
     gtggtgaatg cgcatgttgc cgtcaagttc atctacgttc gtgtcttccg gggaacgaac      1020
     tcgatgcata gccgatcatt cctggcgcgg ttactgtggg ccgcgatatg tgcggcgctt      1080
     tggatcttgt cgtggatcat cgcggaggga ataccggttt tcaacgatgt gctggggctt      1140
     gcgagttcct tatttgctag ttggttttca ttcgggctac cagggctgtt ttggctctac      1200
     ttgaaccgaa gttgttggtt cctgacctgg cgacagagag tgttgttcgg cttcaatatc      1260
     tttctggtgt ttctgggatt tgtcattgtg agttgtgttc cactgtaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page