(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE181

PENCW_13.PE181       Location/Qualifiers
FT   CDS_pept        complement(426741..427043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671369"
FT                   /orf_name="Pc16g01810"
FT                   /product="Pc16g01810 protein"
FT                   /protein_id="CAP92851.1"
FT                   /db_xref="UniParc:UPI00018316CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H759"
FT                   /transl_table=1
FT                   /translation="MPNLPLSRSWPEIRQALEHARECEDGPVNAQSAAVLEAAITELWN
FT                   RIQAQPESYVLTPDEFALFNYFLATRYRGSTVAQRAVARFWNSYQKTTNCDGVSN"
     atgcccaacc ttcctctatc tagaagctgg ccggaaatac gacaggccct agaacacgct        60
     cgagaatgtg aagatggccc cgtgaatgcc caatctgccg ccgtcttgga ggctgccatt       120
     accgaactct ggaatcgcat ccaggcccaa ccagagagct atgtgctcac gccagacgag       180
     ttcgccctgt ttaattactt ccttgctacc cgctaccgtg gctcgaccgt cgcccagagg       240
     gccgtagccc gtttctggaa cagttaccag aaaaccacga attgcgatgg cgtgtccaac       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page