(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE182

PENCW_13.PE182       Location/Qualifiers
FT   CDS_pept        join(429792..429864,429920..429963,430082..430208,
FT                   430270..430670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128406"
FT                   /orf_name="Pc16g01820"
FT                   /product="Pc16g01820 protein"
FT                   /protein_id="CAP92852.1"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI00018316D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H760"
FT                   /transl_table=1
FT                   /translation="MVFYFTSTVVEPSAFIYVGKDKFENEDLIKYGLDNDVWYFHVDNL
FT                   SSAHVYVRLREGETWDNIAQPLLEDCAQLTKANSIEGNKKDNITIIYTPWSNLKKDGSM
FT                   AAGQVTFHNHKLVRKIYVKQRENPIVNRLNKTRVEKFPDLRAEKEEDMKKKQRSDRKAR
FT                   DEQRAKEKKKQQEYEQLKWQKNHAYDDMFTEENMEASNNQDRDEDFLDDFM"
     atggttttct atttcacgtc gacggtcgtc gaaccttccg cctttattta tgtcggcaag        60
     gacaaattcg agaacgagga tctcataaaa tatggattgg acaatgatgt ctggtatttc       120
     cacgtcgaca atctgtcaag tgcacacgtc tatgtacgac ttcgagaagg cgaaacgtgg       180
     gacaacatcg cccaaccgct tctagaggac tgcgctcaac tcaccaaggc gaactccatt       240
     gaagggaaca agaaggataa tatcaccatc atctacacac catggtcaaa cctgaagaaa       300
     gacgggtcaa tggcggccgg tcaagtcaca ttccataatc acaagctggt ccgcaagatc       360
     tatgttaagc agcgcgagaa cccaattgtc aaccggttga acaagacccg agtcgagaaa       420
     ttccccgatc tccgagccga gaaggaagag gacatgaaga agaagcagcg cagtgaccgc       480
     aaggcccgag atgaacagcg tgcgaaggaa aagaagaagc agcaagagta tgaacagctc       540
     aagtggcaga agaatcatgc atatgatgat atgttcacgg aagagaatat ggaggccagc       600
     aacaaccagg accgtgacga ggatttcctc gacgacttca tgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page