(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE183

PENCW_13.PE183       Location/Qualifiers
FT   CDS_pept        join(431282..431315,431363..431466,431522..431941,
FT                   431995..432710,432770..432876,432940..433181)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946614"
FT                   /orf_name="Pc16g01830"
FT                   /product="Pc16g01830 protein"
FT                   /protein_id="CAP92853.1"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniParc:UPI00018316D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H761"
FT                   /transl_table=1
FT                   /translation="MSEGNPPSATPSAKSKKNKKKAAKAKADSKADEHAEDAPGDHDDT
FT                   DNEPHDANEDPIQVPESNGAKLNTIDGSLPDRSVNNQGPVATSDVPSGTDIHSDPASDG
FT                   TEPKDRFDALVRDRDSLRAEVADMRKSLEEIQSKHTADMEALQQKLDDAENKKEQAETQ
FT                   FQMLLERVNTIKSQLGERLKEDAEELALARSQIEDLEDENNNLKDELNSKSTQLIELSE
FT                   DSAEKEKELSTLRDRTNLSQQNWLKEKEELLEQESYLQSEFEQAKEAMHNWEILAMEER
FT                   SIRENLNEKVADLEEQLSSLRDGYERATHERDTQQSTVDGLQRALQEIQLARKQELREL
FT                   VESSDSQLENLRRSLREAQKQATDADKALQNAKEEIERVRPFEKEVKEKNLLIGKLRHE
FT                   AVTLNDHLTKALRFLKKGKPEDNVDRHIVTNHFLHFLALDRSDPKKFQILQLIAALLGW
FT                   NDEQREQAGLARPGTSSMPGKLRVPGTPLRTPSTPNLATEFMDNGASSKETLAELWSNF
FT                   LEQEAEVGNMSSSRRGSQQGPPK"
     atgagtgagg gaaatccacc gtctgctaca ccaagcgcaa agtccaagaa gaacaagaag        60
     aaggccgcaa aagccaaagc cgactccaag gccgacgagc atgcagagga tgcgccaggc       120
     gatcacgatg acacagataa cgagccccat gatgccaacg aggaccccat acaagtgcca       180
     gaatccaacg gcgccaagct taacacgata gatggcagtc taccagatcg gtctgtgaat       240
     aaccaggggc ccgtggctac tagcgatgtc ccctcaggaa ccgatatcca ttccgatcct       300
     gcttccgatg gcaccgagcc aaaggaccga ttcgatgcac ttgtccgaga tcgcgactcg       360
     ttacgcgccg aagtagccga catgcgaaaa tcattggaag agattcagtc caagcacacc       420
     gcagacatgg aggccctgca gcagaaattg gacgacgcgg aaaacaaaaa ggagcaggcg       480
     gaaacgcagt ttcagatgct cctggaacga gtcaacacca tcaaatcgca attaggggag       540
     cggctcaaag aggatgctga ggaattggcc ctagcgcgat cacaaatcga agacctcgaa       600
     gatgagaaca acaacttgaa ggatgagctc aattcaaagt ccacccagct gatagaacta       660
     tcggaggact cagcagagaa agagaaggaa ctgtctactc ttcgggaccg gacaaactta       720
     tcccaacaga attggttgaa ggagaaggaa gaattgctcg agcaagagtc gtaccttcag       780
     tcggagtttg agcaagcgaa ggaggctatg cataattggg aaattcttgc catggaggaa       840
     cgatctatcc gggagaactt gaacgagaaa gtcgcggatc tggaggagca gcttagcagt       900
     ctaagagatg gttatgaacg ggccacccat gaacgtgaca cccaacagtc aacagttgac       960
     ggccttcagc gggctttgca ggaaattcaa ttggcgcgaa agcaagagct gcgagagctt      1020
     gtggagagct ctgattctca actcgagaac ctcagacgct ctctgcggga agcacagaag      1080
     caggccactg acgccgataa ggctctccag aatgcgaaag aagagattga gcgagtccga      1140
     ccatttgaga aagaggtcaa agagaagaac cttctcattg gcaagctacg gcatgaggca      1200
     gtcacgttga atgaccatct gacgaaagcc ctacgattcc tcaagaaagg aaagccggag      1260
     gataatgttg acaggcatat tgtcaccaac catttcctgc acttccttgc tttagaccga      1320
     tctgatccga agaaattcca aatattgcaa ctgattgctg ccctcctagg ctggaacgat      1380
     gagcaacgtg aacaggcagg ccttgcccgc ccagggactt cgagtatgcc cgggaagctc      1440
     cgagtccctg gcactcccct ccgcaccccg agcacgccca atctggcaac ggagtttatg      1500
     gacaatggtg cctctagcaa ggaaacacta gccgaactat ggtctaattt cctggagcag      1560
     gaagcggagg tgggtaatat gagttcatcg cgacgaggaa gccagcaagg gcctcccaaa      1620
     taa                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page