(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE184

PENCW_13.PE184       Location/Qualifiers
FT   CDS_pept        join(433511..433520,433602..433706,433782..433889,
FT                   433944..434074,434131..434367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946615"
FT                   /orf_name="Pc16g01840"
FT                   /product="Pc16g01840 protein"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /protein_id="CAP92854.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI00018316D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H762"
FT                   /transl_table=1
FT                   /translation="MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPR
FT                   PGEQDGREYNFVTKDAFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIE
FT                   MEGVKQVKRTDLNARFLFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQP
FT                   AAHDKIVVNDDLEKAYAELRDWVVDGGKFGAAQ"
     atggcttccg cataccgccc tattgtgatt tcaggcccat cggggactgg aaagtcgact        60
     ctgctcaaga ggttgttcgc cgagtatcct gatacgtttg gattctctat ctcggaaact       120
     acacgatccc cgagacctgg cgagcaagat ggccgtgaat ataacttcgt cacaaaagac       180
     gctttcctcg acctagtggc taagaacggg tttattgaac atgctcaatt tggcgggaat       240
     ttctatggga cgtcggtcca ggctgtcaag aacattgccg agaagaagcg tatctgcata       300
     ctggacattg agatggaagg agtcaagcag gtgaagcgga cggatcttaa tgcgcgtttc       360
     ttgttccttg cgccgccttc tctcgaggtg ctggagcagc gcctccgtgg tcgtggcact       420
     gagaccgaag aatctctaca gagaagactt actcaagctc gcaacgagct tgagtatgca       480
     aaccaacccg cggctcacga taagattgtg gttaacgacg atctagagaa agcgtatgct       540
     gaattgcggg attgggttgt tgacggtggt aagttcggtg ctgcgcaata g                591
//

If you have problems or comments...

PBIL Back to PBIL home page