(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE185

PENCW_13.PE185       Location/Qualifiers
FT   CDS_pept        join(complement(435949..436087),complement(435759..435887),
FT                   complement(435622..435703),complement(435430..435567),
FT                   complement(435145..435358),complement(434752..435096))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946616"
FT                   /orf_name="Pc16g01850"
FT                   /product="Pc16g01850 protein"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAP92855.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00018316D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H763"
FT                   /transl_table=1
FT                   /translation="MAAATTAAQAQQPTVFPHSHVGFDSITSQIERKLLKRGFQFNVMC
FT                   VGQTGLGKSTLINTIFASHLIDSKGRLTPSEPVRSTTEIKTESHIIEENGVRLRLNIVD
FT                   TPGYGDQVNNDRCWDPIVKYIKDQHSAYLRKELTAQRERYIQDTRVHCCLFFIQPSGHA
FT                   LKPIDIVVLKKLSDVVNVVPVIAKSDSLTLEERQAFQERIKEEFSFHNLKMYPYDNDEL
FT                   DDEERAINAQIKLQDIIPFSVVGSEKTIVVNGKQVRGRQNRWGVINVEDENHCEFVYLR
FT                   NFLTRTHLQDLVETTSQIHYETFRAKQLLALKESSAAGGHTGGSRPISPSADRELSRNS
FT                   QRAAMNGY"
     atggccgccg ctaccaccgc agctcaggct caacagccca ctgttttccc ccatagccat        60
     gtcggttttg acagcattac ctcgcaaatc gagcgcaagc tgttgaagcg tggcttccag       120
     ttcaatgtta tgtgtgtcgg ccaaactggt cttggaaaat cgactctgat caacactatc       180
     ttcgcatccc acctgattga ctccaagggc cgtctgacgc cctctgagcc cgttcgctcc       240
     accaccgaga tcaagacgga gtcgcacatt attgaggaga acggcgttcg tctccgcttg       300
     aacattgtcg acacacctgg ttacggtgac caggtcaaca acgaccgatg ctgggaccca       360
     attgtcaagt acatcaagga tcagcactca gcatacctcc gcaaggaact caccgctcag       420
     cgtgagcgtt acatccaaga tactcgcgtt cactgctgct tgttcttcat ccagccctcc       480
     ggccatgccc tcaagcccat cgatatcgtt gttctgaaga agctgtccga tgtcgtcaac       540
     gttgttcccg ttattgccaa gtccgactct ctcaccctcg aagagcgtca ggcgttccag       600
     gagcgcatca aggaggagtt ctccttccac aacctgaaga tgtaccctta cgataatgac       660
     gagctcgatg atgaggagcg tgctatcaac gcccagatta agctacagga catcattcct       720
     ttctccgttg tcggcagtga gaagaccatt gttgtcaacg gcaagcaagt tcgcggccgc       780
     cagaaccgct ggggtgttat caacgtcgag gatgagaacc actgtgaatt cgtctacctg       840
     cgcaatttcc tgacccgcac ccaccttcag gatctggtcg agactaccag ccagatccac       900
     tacgagacct tccgtgccaa gcagctgctt gccctgaagg aaagcagcgc tgccggtggc       960
     cacaccggtg gcagccggcc catcagcccc tccgcggacc gtgagctgag ccgcaactcc      1020
     cagcgcgcag ccatgaacgg atactaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page