(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE186

PENCW_13.PE186       Location/Qualifiers
FT   CDS_pept        join(436375..436711,436780..436817)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946617"
FT                   /orf_name="Pc16g01860"
FT                   /product="Pc16g01860 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP92856.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00018316D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H764"
FT                   /transl_table=1
FT                   /translation="MALRLLPFAPATMSRSLLSESLQFPRLARFPPITPIATRFLQPVS
FT                   ISLNIPSLLSDLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKSLNKCPGCGQIKRAH
FT                   LLCPNCVKDIKESWRTLDMA"
     atggcattgc gcctcctccc tttcgctccg gcaaccatgt cgcgctccct tctttccgag        60
     tcactccaat tcccccgact cgctcggttc cccccgatca cacccatcgc gaccagattc       120
     ttacaaccgg tttcaatctc cctcaatatc ccatccctgc tgtcagatct ttgggattcc       180
     gttctgcgcg ccgttcctaa gaagaagacc tcccacatga agaagcgtca ccgacaaatg       240
     gccggcaagg ccctcaaaga cgtgaagagt cttaataaat gcccgggctg tggccagatc       300
     aagcgtgccc atcttctctg cccgaactgt gttaaagaca tcaaggaatc gtggaggacc       360
     ttggacatgg catga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page