(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE19

PENCW_13.PE19        Location/Qualifiers
FT   CDS_pept        complement(43746..45080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945513"
FT                   /orf_name="Pc16g00190"
FT                   /product="Pc16g00190 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92689.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831DB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T0"
FT                   /transl_table=1
FT                   /translation="MSPRFPSENVDVSPLGAPLQFEFSQRKASNRFLKAALTERMASWS
FT                   PADLSARGIPSQNLINLYRRWGEGQFGLILTGNIMIAYDQLESPGNMIIDLENPLSGER
FT                   FEAFKQLATAAKKHGSLIVGQVSHPGRQTFEKLQPNPVSASDVQLVMEKFGAFGKPHAA
FT                   TEEEIQDIIRRFVHVAVYLQKAGYDGIQLHSAHGYLLAQFLSQTTNKRTDKYGGSLANR
FT                   ARIIVEIAQAIRQAVSDPGFIIGIKINSVEFQEHGFTPEESKELCEILDQTNFDFVELS
FT                   GGTYEAGAFQHKRESSQKRESFFLEFADLITPALKRTRSYVTGGFCTASGMVQALKTVD
FT                   GVGLGRTITQEPRLPRELLSGSVKGAIQQKIDPQDFFKTSPAAGAQMLQIAQDEEPIDL
FT                   SCDANMEVFMKSLGEWAQQMQKDGAAMNMYGYAQLPKGQPFQSHL"
     atgtctccca ggtttcccag cgaaaatgtc gacgtatcgc ctcttggtgc ccctttgcag        60
     ttcgaattca gtcagcgcaa agcttcgaat cgttttttga aggccgctct gacagaacga       120
     atggcctcct ggtctccggc ggatctttca gctcgaggta ttcccagcca gaatctcatc       180
     aatctttacc gtcgctgggg agagggtcaa tttggactta tcctcaccgg caacattatg       240
     attgcatatg accagctcga gtctccggga aacatgatca ttgatctcga gaacccactc       300
     agcggtgaaa gatttgaagc attcaaacaa ttggccacgg ctgccaagaa gcacggaagt       360
     ttgatcgttg gtcaggttag ccatcccggt cgtcagacgt ttgagaagct gcaaccaaac       420
     ccggtttctg ctagcgatgt ccagctggtc atggagaaat tcggcgcatt tggaaaaccc       480
     cacgcagcta ccgaggagga gattcaggat attatccgcc gctttgtgca tgtagccgtc       540
     tacctgcaaa aggctgggta cgacggtatt cagctgcatt ccgcccatgg ttatctcctc       600
     gcgcaattcc tgtcccagac gacgaacaag aggacagata aatacggtgg gagcctggcc       660
     aaccgtgccc ggattattgt cgaaatcgcc caggctattc gccaagcagt gtcggatccc       720
     ggctttatca ttggaattaa gattaactcg gtggaattcc aagaacatgg atttaccccc       780
     gaggagtcaa aggaactgtg tgagatcctc gaccagacca actttgactt tgttgagttg       840
     tctggcggaa catatgaagc cggtgccttc cagcacaagc gggagtcttc gcagaaacgg       900
     gaatcattct tcctggaatt cgcagacctc atcactcctg ctctcaagcg cacccgcagc       960
     tatgtgactg gaggattttg cacagcgtct ggaatggtcc aggctctgaa aacagttgat      1020
     ggcgttggtc ttggccgcac cattacccag gagcctcgct tgccaaggga gctgctctcc      1080
     gggagtgtga aaggtgcaat ccagcagaag atcgatcccc aggacttttt caaaacaagc      1140
     cctgctgctg gcgcacaaat gttgcagatc gcacaagacg aagaaccgat tgatctgagc      1200
     tgtgatgcca atatggaagt tttcatgaaa agtcttggag aatgggcgca gcagatgcag      1260
     aaagacgggg ctgcaatgaa catgtacggt tatgctcagc ttcccaaggg tcaaccattc      1320
     cagagccatc tgtga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page