(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE191

PENCW_13.PE191       Location/Qualifiers
FT   CDS_pept        join(complement(447050..447184),complement(446878..446997),
FT                   complement(446525..446818),complement(445938..446460),
FT                   complement(444307..445772))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946619"
FT                   /orf_name="Pc16g01910"
FT                   /product="Pc16g01910 protein"
FT                   /protein_id="CAP92861.1"
FT                   /db_xref="InterPro:IPR018744"
FT                   /db_xref="UniParc:UPI00018316D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H797"
FT                   /transl_table=1
FT                   /translation="MARVTRRAASASARHGAGRAVQRRARRHKVIMESVTQEKKKLRSV
FT                   ICFEAQAPSGYTFIPAGNPQLTTTCKERCRAEGLQIHAVSTTPHHRHHNLSQHVHRIGY
FT                   HFPSTVVAAVCSELGFYLTSTGKTVPSTFPTDRIENSKRADSEVSQITLNTEARDALKD
FT                   LFPNIPDKDLNQIIKTAFQKGQNKVGTATELPLARRVQLAVVAHVRHVYTDYDRLLKTT
FT                   SFHEARGVVEHTTLAKVIEWRGDDENGQTVLEDVFREVIVISDDDDSESEEETADLAGH
FT                   QNTSVEILPSDTRAHEIRSQPINNTNPLGRDLARELSEEAPPGFRFVTRAPATDTINRR
FT                   GFNRYKAWTRAVKEYREASNDSQAHRVPAIPLMDRQVAKRHVGVQENYLHSDVQQKYSA
FT                   HELNARPTGLTNQESPELQILEELSGPRNVNMSHSQDVPPPRMEPRFRQRLPPQSDRTN
FT                   APVFVSGPKDNRQKLTPVGRRPDAGNSPLLRLGSNTQDSILPSIENPRPPENRRTDGAN
FT                   PLVHMANKMSLRSVTPGHPQGEMMPQPDVIEKEGDSGQASKRRRLACREGSRTESRPDP
FT                   WSARPMGLPVSDGFGPPSYRPVELVPDYRAQDQPHFRRDYLPVEPPPVVGYQRESNPNA
FT                   FSYSSAQHGPETRSVLGRQPISGPHEPQSKVGLSGTSIIVSEGDRNFRAAPAVSDSGPW
FT                   HLYHGDRSFRSDCVPKEPRAIRRTRIDGGRPLSENVHSDRNLYAEDFVRHVDHREPPPF
FT                   EYVSRRAGPAAKPIGESSQTARTRDLDYLGTKNLSQTQVSSDQHRPLPIGRVAPSHDHL
FT                   RTFSDPVGKIQPHVSLPQVPRERPASGGFNSSR"
     atggcccgtg tcacaaggag ggctgcctcg gcctcggcca ggcatggcgc tggccgggct        60
     gtccaaagaa gagcaagaag acacaaagtt attatggaat ctgtcaccca agaaaagaag       120
     aagcttcgca gtgtgatctg ttttgaggcg caagcaccaa gtggttacac attcattcct       180
     gcaggaaatc cgcaactcac tacaacgtgt aaggagcgat gccgagccga gggtctccaa       240
     atccatgcag tatcgactac cccacatcat cgccatcata acctgtctca gcatgttcat       300
     cggataggat atcattttcc tagcactgtg gtggcagctg tttgctcaga gctggggttc       360
     tacctcacaa gcactggtaa aacagtgcct agtacctttc ccacagacag gatagagaat       420
     tcgaagcggg ctgattctga agtttctcaa ataaccctca acacagaagc acgggatgcc       480
     ttgaaggatc tctttccgaa cataccagac aaagatttga atcaaattat caagaccgct       540
     tttcaaaagg gccagaacaa ggttgggacg gccaccgaat tgcctttggc tcgcagagtt       600
     caacttgccg tggttgctca tgttcgacat gtctacactg actacgatcg cctcctgaaa       660
     accacttcat tccatgaagc tagaggggtt gttgaacaca caactctagc aaaagtcatt       720
     gagtggcgag gggatgatga gaatggccag acagttctgg aagatgtttt ccgcgaggtg       780
     atcgttatct cagacgacga tgacagtgaa tcagaagaag agacggccga tttagcaggt       840
     caccagaaca ccagtgtgga aatacttcca agcgatactc gggcccatga gattcggagc       900
     cagcctatca acaataccaa tcctcttggt cgggatctcg cacgggaact atctgaggaa       960
     gcgccgcctg ggttccgatt tgtcacaaga gccccagcca cagataccat caaccgtcga      1020
     ggatttaaca ggtacaaagc atggacccgc gctgtcaagg aatatagaga ggccagtaat      1080
     gatagccaag cacatcgagt gcccgctatt ccactaatgg accgacaggt ggctaagaga      1140
     catgtaggtg tccaggagaa ctatcttcac tcggatgtcc aacaaaaata ctcagcccat      1200
     gaactgaacg ccaggccaac tggactaact aatcaggaat cacccgagtt gcaaatccta      1260
     gaagaactat ctgggcctag aaatgtgaac atgagccact cgcaggatgt tcctcccccc      1320
     aggatggagc ccagatttcg acaaagactg cctcctcagt cggaccggac caacgcacct      1380
     gttttcgtga gcggaccaaa ggacaaccgt cagaaattga ccccagtggg acgccgccct      1440
     gacgccggca attcccctct tctcagatta ggctcaaaca cacaggattc tatcttgccc      1500
     tcgattgaaa atccccggcc accagaaaac cggcgaactg atggtgcgaa tcccttggta      1560
     catatggcca acaaaatgtc cctccggtct gtcacgccag ggcatcctca aggagagatg      1620
     atgcctcagc ccgatgtcat tgaaaaggaa ggtgacagcg gacaggcgag caaaagaagg      1680
     cgtctggcat gccgtgaagg ttctcgaacc gagtcccgcc cagacccgtg gagtgcaagg      1740
     cctatgggac ttcccgtttc cgatggattc ggaccaccct cttaccgtcc ggttgagctt      1800
     gtcccagact accgagccca ggaccagcct catttccgcc gggactatct gccagtggaa      1860
     ccgccccctg ttgtaggata ccagcgggaa agcaacccca atgcgttttc ttattccagc      1920
     gcacaacatg gcccagaaac aaggtcagtc ttgggtcgac agcctatcag cggaccacac      1980
     gagcctcagt ccaaggttgg gctttccggt accagtatca ttgtctcgga aggggatcgc      2040
     aattttagag cggccccggc cgtttccgat tctggaccgt ggcatctcta tcatggtgat      2100
     cgtagtttcc gttcggattg tgttccgaaa gagccgcggg ccattcggcg cacccgcatt      2160
     gacggtggtc gccctttatc agagaacgtc cactcagaca ggaacctgta tgccgaggac      2220
     ttcgtccggc atgttgacca ccgtgagccc cctccatttg aatacgtctc caggcgtgca      2280
     ggtccagcgg ccaagcccat tggagaatct tctcagaccg cccggactcg agaccttgac      2340
     taccttggca caaagaatct gtctcagacc caggtttcct cggatcaaca caggcccttg      2400
     cccataggac gagtggctcc ttcccatgac caccttcgca ccttttcaga ccctgtggga      2460
     aagatccagc ctcacgtgtc cctccctcag gtccctcgtg aaagaccagc cagtggcggg      2520
     tttaactcct cgcggtaa                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page