(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE192

PENCW_13.PE192       Location/Qualifiers
FT   CDS_pept        447782..448090
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671370"
FT                   /orf_name="Pc16g01920"
FT                   /product="Pc16g01920 protein"
FT                   /protein_id="CAP92862.1"
FT                   /db_xref="InterPro:IPR013884"
FT                   /db_xref="UniParc:UPI00018316D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H798"
FT                   /transl_table=1
FT                   /translation="MNASIQAMKVDQRAMIHAYRHLYRQGLKAIQYSTPGRHILLKSLR
FT                   NSYRSSPSEQFDPAKITNTLRFLERATEVAGMEHKILKNLLLARYWEQGHLARESRV"
     atgaacgctt caatccaggc catgaaggtg gatcaacgag ctatgatcca cgcataccgt        60
     cacctctacc gacaggggtt gaaagcaatt cagtattcga caccgggtcg ccatattctt       120
     ctaaaatcct tgcgaaactc ctatcgttcc tccccctccg aacagtttga tcctgccaaa       180
     attaccaaca cccttcgttt tctcgaacga gctacagagg tcgcgggcat ggaacacaag       240
     attttgaaga accttctact agctagatat tgggagcaag gtcaccttgc gagagagtcc       300
     cgcgtgtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page