(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE193

PENCW_13.PE193       Location/Qualifiers
FT   CDS_pept        join(448941..450173,450224..450588,450640..451228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946620"
FT                   /orf_name="Pc16g01930"
FT                   /product="Pc16g01930 protein"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018316DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H799"
FT                   /transl_table=1
FT                   /translation="MSGFISSLLIQIGIRSPLPPQPSKQPNDDQAKFHLNEPTNPSCNS
FT                   EDHKFGPQLDQDHGQKSNCGDAGAGSLHSPPFFTTLPKEMDGRNLQAEGTRSVTDNTPG
FT                   SRNIAATTVGSLDPTYEIDVTAQPDGSGNPQGSHPSEVSNSPSEPQYAASGIAIGEPRR
FT                   SLDNALDPEGLTQSSLPADDGMGVLRSKIIAIRELGLTNVEKARMVHGLMTEGYNSSRE
FT                   LPNTSSPPSLELPTSPRTPRASEINTSRPGSPYTESVPLYESTFNLTTEDLQPTFVPKA
FT                   ETEPPELETGDEDCDTEEQEETILGCVHYQRNVKLECYTCKKWYTCRFCHDEVEDHTLV
FT                   RRDTEHMLCMLCGHAQPAAQNCRQCSEQTAQYYCEICKLWDNDSKKSIYHCSDCGICRI
FT                   GQGLGKDFFHCQTCSVCLPMCIENTHRCIERSTQCDCPICGDYMFTSPETVVVMRCGHS
FT                   IHHKCLSEYSKSSFRCPLCSKTITNMESTFRNLDRTIESQPMPEEFKDTKGLIYCNDCG
FT                   SKSVVKYHWLGLRCDLCESYNTAQLRILHGDMSAQPDEDSGEDLLPRPRSSSVIENDDS
FT                   MSSSLAALNVNNTSVPRSRLSVPMSPEPVRRFSSYNITRGRAVSPVVSNYFGLPTERES
FT                   EKPSSMPFFGGPSRGENEDYGALNFLSKKLTYRYGLFGGETKSVEKVLETGDEEEDDDD
FT                   GESSDSAESDGSHGTEDDEEEEEDQDHIQIFGHQ"
     atgagtggtt tcatttcctc actgctgatc caaattggaa tacgatcccc cctaccaccc        60
     cagccgagca aacaaccgaa tgacgaccag gctaaatttc acctgaacga gccgacaaac       120
     ccctcttgca atagtgaaga ccataaattt ggtccccaac tggatcaaga tcacggacag       180
     aaatcgaact gcggagatgc gggtgcgggg tccctgcata gccctccttt cttcacaacc       240
     ctaccgaaag agatggatgg ccgaaacttg caagcggagg gcactcgatc agtgaccgac       300
     aacacgccgg gatcccgaaa catagccgcg accacagtcg gctcattaga tcctacatat       360
     gaaatagacg tcaccgcgca gccggacggt tcagggaatc cacaaggttc acaccctagt       420
     gaggtgtcaa actcgcctag tgagccacaa tatgctgctt caggaatagc cattggggag       480
     cctcggcgat ctttagacaa tgccttggat ccggaagggc tgacacagtc ttcgcttccg       540
     gcagatgatg ggatgggagt tttaagaagc aagatcatcg caattaggga gttgggcctg       600
     acaaatgttg aaaaggcgcg aatggttcac ggcctaatga cagaaggtta caactcatcc       660
     cgtgagctcc caaacacatc cagtccaccg agcctagaac tgccaacaag cccgaggact       720
     ccccgggcct cggagatcaa tacttctaga ccgggctcgc catacaccga atcagttcct       780
     ctatatgaga gcaccttcaa tctcacaact gaagatctgc agcctacttt cgtacccaag       840
     gcagaaacag aaccaccaga acttgaaacc ggggatgaag actgtgacac agaagaacaa       900
     gaagagacta ttcttggatg tgtgcattat cagcgcaacg taaaacttga gtgctacact       960
     tgcaaaaaat ggtatacctg ccgcttttgc catgacgaag tggaagacca cactctcgtt      1020
     cgtcgagaca ccgagcacat gctctgtatg ctatgcgggc atgcacagcc tgcagcgcag      1080
     aactgcagac agtgcagcga gcaaactgca cagtattatt gcgagatttg caagctctgg      1140
     gataatgaca gcaaaaagag catatatcat tgcagcgact gcggtatatg tcgaattggg      1200
     cagggattgg ggaaggattt cttccattgc caaacatgct ctgtttgtct tcctatgtgc      1260
     atagagaaca cccatcgttg catcgaacgg tccacccagt gtgactgccc catctgtggt      1320
     gactacatgt tcacttctcc agaaaccgtc gttgtcatgc gatgtggcca cagcattcac      1380
     cacaagtgtc tgtcagagta ctctaaaagt tcgttccgtt gtcccctttg tagcaagacc      1440
     atcaccaaca tggagtcgac attccgaaac ctggatcgca ccattgagag ccagcctatg      1500
     cccgaggagt tcaaggatac caaaggcctt atttattgca atgactgcgg ttcgaagtct      1560
     gttgtgaagt atcactggct cggcttaaga tgcgatttat gtgagtcgta caatacggcc      1620
     caacttcgca ttttgcacgg agacatgtct gctcagcctg atgaggactc cggggaagac      1680
     ctccttcctc ggcctcgatc gtcttcagta attgagaacg atgactcgat gtcatcttcc      1740
     ctagcagcat tgaatgtcaa taacacatcg gttcctcgtt cacgactcag tgttcctatg      1800
     tcacctgaac ccgttaggcg attctcatcc tataacatca cacgaggccg tgctgtctcg      1860
     cccgtcgtca gcaactactt tgggctgccg actgagcgtg aatcagagaa gccttcatcg      1920
     atgcccttct ttggaggtcc atctcgtggc gaaaacgagg attacggtgc attaaatttc      1980
     ttgagcaaga agcttacata ccgatatgga ctgtttggcg gtgagacgaa atcagttgaa      2040
     aaagtattgg aaactgggga tgaagaagaa gacgacgacg acggagagtc ctctgactcg      2100
     gctgaatcgg atggttctca tggtactgag gacgacgaag aggaagagga agatcaagat      2160
     cacatccaga tttttggtca tcagtga                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page