(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE194

PENCW_13.PE194       Location/Qualifiers
FT   CDS_pept        join(451260..451519,451567..451702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946621"
FT                   /orf_name="Pc16g01940"
FT                   /product="Putative uncharacterized protein Pc16g01940 "
FT                   /protein_id="CAP92864.1"
FT                   /db_xref="UniParc:UPI00018316DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A0"
FT                   /transl_table=1
FT                   /translation="MADGLVYRPGECDPAALFLPSSIIPSQAVHRAMNTVQLERSPTPL
FT                   VGFDFRSISDPVPHRVDKNPSRPIPFCTKAISLSLCVPLHMGQPSEGQLNALRGCWSYI
FT                   HQAAGFAAALRSLLFWLSKHTGVMTQR"
     atggctgatg ggttggttta tcgtcctggg gagtgtgacc cagcagctct attcttgccc        60
     tcatcaatta tccccagtca agccgtgcac cgagcaatga acactgttca acttgaacgc       120
     agtcctaccc cgttagtggg cttcgatttc aggagcatct ctgacccggt accccatcgg       180
     gttgataaaa acccctcgag gccgattcca ttctgtacta aggcgatatc tctgtcactc       240
     tgtgtacctt tacacatggg tcaaccaagc gaaggccaac tcaacgcatt gcggggatgt       300
     tggtcttaca tacatcaagc agccggtttc gctgcagcat tgcgttcact tcttttttgg       360
     ctttcaaagc acactggtgt catgacgcaa cgatag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page