(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE195

PENCW_13.PE195       Location/Qualifiers
FT   CDS_pept        453082..453459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946622"
FT                   /orf_name="Pc16g01950"
FT                   /product="Pc16g01950 protein"
FT                   /protein_id="CAP92865.1"
FT                   /db_xref="UniParc:UPI00018316DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A1"
FT                   /transl_table=1
FT                   /translation="MQIIHGKGEERHFKVTHELSQPYRLYNIVHDPSHLTQITIFDPKV
FT                   PLREETRSQPDQFVAIISENGAKGELDTSHTSPWNRQVASEGNNENVGERKDLCFVPYY
FT                   LRADRGGRGRGQMRVSVLSTE"
     atgcagatca tccatgggaa gggcgaagag cgtcatttca aggtaacgca cgaactatcc        60
     caaccatata ggttatacaa catagtacat gaccctagtc atttgacgca gataacgatc       120
     ttcgatccta aggttcctct acgagaagag acacgatctc agcctgacca gtttgtggct       180
     atcatttccg aaaatggagc gaaaggtgaa cttgacacgt cccacacgtc cccttggaat       240
     aggcaggttg catctgaggg taataatgag aatgttggag agaggaagga tttgtgcttt       300
     gtgccatatt atttgcgggc ggatcgaggt ggacgaggaa gaggacagat gagggtctcc       360
     gtgttaagta cggagtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page