(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE196

PENCW_13.PE196       Location/Qualifiers
FT   CDS_pept        454035..456974
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824076"
FT                   /orf_name="Pc16g01960"
FT                   /product="Pc16g01960 protein"
FT                   /protein_id="CAP92866.1"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniParc:UPI00018317AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A2"
FT                   /transl_table=1
FT                   /translation="MIRRNSDIEIQLPDAGPTPLSPESVSDLDVEMLSEESALPLSLPP
FT                   HIAARFYRKSSKARRSSAVSSRRSSVSSLHSHHSNTSSNGSPGADHIAQHLRRTSILES
FT                   RKARLADRALHAEKVRLRAALAKAATRNLQFEERALAAQQARERLLADITAKCEDQVKR
FT                   AKKKAEDQREKKAAEQARLRLEMAEKLAEAEKRRTLYQQTHRRQRTSSLPATEEKKMSR
FT                   EVTKSLTQDAAARKIQRVWRTHNAKMTMQRFQSLNLSVARVRDMTFEEVGALLSNRKLL
FT                   DTMTNVLRLCGLQDMEGGAMGERGAVRTFLSSYLIVTHPKEVLSSDGDQEQDLIAKARE
FT                   LLVAFDQVTALLSSGCCSPSVITADLQTLCESHNVFFSAFHAWKSHDSSVLIEIMVAQF
FT                   VELELIWQTVKNDKAGGAAEDYRLGIRQNQVLLLARLKRLAGPDRHMEMIRDSLKKAKR
FT                   EKKRAAPKQAIPRSAETAPPTTEATQSVTSPLSESFNNIDAAVFQELDKQRTSPHERFT
FT                   KILTPLPENRELVHELLINKEFKIEEAPYTEPRRQIMKQMCDTMRRGVEAGHGTNWTVA
FT                   MATVIQDRLLRSLQRGNSLYVIISEVLDPKLVQGQCEAGTFSYDNFFEFMNNILPRLCA
FT                   PYRDPVVKAYIEDTSGDAIDRLARLMSIIDLLSLDQTNFMIQLAAPQLIEEAPGYEKRA
FT                   FDRDVTDGTISLGKTRRFWRIHRKIIVDEMKKRDPEGVQGEPRPSSARVYAQGLADTVL
FT                   SNAVVSEDLVPETLSLDRQRLERLHAKAFQIVATASILLTAKNLLKRDARSQWKPEADR
FT                   ILSLDFNEISAERVQSILEATHPMPPAASAQLKATIKRVLGPVATACLAAAPQLAVVTS
FT                   ETSASDASVSSTDSPGTTTSAPSFSDPVTKLILSRLRGHVLSRLSASSASERVRATTTA
FT                   SQNLAGAGMPEFVNEVGKLVEELEKVREVDWLCHGAIYEGLYEEGVPAQ"
     atgatccgtc gcaactccga catcgagatc cagctcccgg atgccggtcc aacccctctt        60
     tcacccgaat ctgtgagcga tctcgacgtg gagatgctct ctgaggagtc ggcacttccc       120
     ttgagtcttc cacctcacat cgcagcccga ttctaccgca aaagcagtaa agcccgccgt       180
     tcctctgccg tctcatctcg acgaagctca gtgtcctcct tgcactccca tcattcgaat       240
     acgtcctcga atggctcgcc aggtgcggac catattgctc aacacctccg ccgcacgtcc       300
     attttggaga gccgaaaggc acgactcgct gatcgtgcat tgcatgcgga gaaagtgagg       360
     ctgcgggccg ctctggctaa agcagctaca agaaatctac aattcgagga gagagcatta       420
     gctgctcagc aggcccggga gcgtctgctc gccgatatca ccgctaagtg cgaagatcag       480
     gtcaaacggg ccaaaaagaa ggccgaggat cagcgggaga agaaagctgc cgaacaagct       540
     cgcttgcgtc tggaaatggc ggagaagctt gctgaggcag agaaacggcg cacactatac       600
     cagcaaaccc atcgccgcca gcgtactagc agcttaccag ccaccgagga aaagaagatg       660
     tcccgagagg tcaccaagtc gcttacgcag gatgcggctg cgcgcaagat ccagcgcgta       720
     tggagaaccc ataatgcgaa gatgactatg cagcggttcc agtcgttgaa cctgtcagtc       780
     gcccgagttc gggacatgac ctttgaagaa gtcggtgctc tcctttctaa ccgcaagttg       840
     ctcgacacta tgacgaatgt cctccgactc tgtggtctgc aagatatgga aggcggagcg       900
     atgggtgaaa ggggcgctgt acgcacattc ctcagcagct acctcattgt cactcaccca       960
     aaagaagttt tgagcagcga tggagaccag gagcaagacc tgattgccaa ggcccgggag      1020
     ctgctagtag cctttgacca ggtcacggcg ctgctatcgt caggctgttg ctctccatct      1080
     gtgatcactg cggatctcca gactctgtgt gaatcacaca atgtgttttt ctctgctttc      1140
     catgcttgga agtctcacga ctctagtgta ctgattgaga tcatggttgc acagtttgtc      1200
     gaattggagt tgatctggca gacggtcaaa aatgacaaag ctggcggtgc tgcagaggac      1260
     tacagactgg gcatccgaca gaaccaggtc ctgttgctcg cccgtctgaa gagacttgcg      1320
     ggacctgacc gacacatgga gatgattcga gattcattga agaaggccaa gcgggagaag      1380
     aagagggctg cccccaagca agctattccc cggtctgctg agactgctcc tccaaccacg      1440
     gaagctacgc agagtgtcac gtcgcctctt agcgagtcgt tcaacaacat agacgccgca      1500
     gtgttccagg agctggacaa gcagcgcaca tccccccacg agaggttcac caaaattctc      1560
     actcctctcc ctgaaaaccg ggagctggtg catgaacttc tcatcaacaa agagttcaaa      1620
     attgaagaag caccgtacac tgaaccgcgc agacagatta tgaagcagat gtgcgacaca      1680
     atgagaagag gggtggaggc tggacacggc accaactgga ctgtcgccat ggccacagtg      1740
     atccaagatc gtttgctgcg ctcgctccaa cgaggcaatt ccctttacgt gataattagt      1800
     gaagttttag acccaaaact ggttcagggg cagtgcgagg ctggcacatt ctcctatgat      1860
     aatttcttcg agttcatgaa caacatatta ccacgcctat gcgctcctta ccgggaccct      1920
     gtggtcaagg catacattga ggatacttcg ggcgatgcta tcgaccggct ggctcgattg      1980
     atgagcataa ttgacctgtt gtcacttgac cagacgaatt tcatgatcca acttgctgca      2040
     ccccagctca ttgaagaagc tcctggttat gagaagcggg cattcgaccg agacgtcacg      2100
     gatggaacga tcagcctggg caagacccgt cggttttggc gcattcatcg caagatcatc      2160
     gtcgatgaga tgaagaagcg agacccggaa ggcgtccaag gagaaccacg cccatcatca      2220
     gcacgagtct acgcccaagg tcttgctgac accgttctaa gcaatgcggt cgtatccgag      2280
     gatttagttc cggagactct gagcctcgat cgtcaacgac tggaacgcct gcatgccaag      2340
     gcattccaaa ttgtagcaac agcttccatc ctgttaacag caaagaacct gcttaagcga      2400
     gatgcacggt ctcaatggaa acctgaagca gaccggatcc tatctctgga cttcaacgag      2460
     atcagcgcag agcgagtgca gtctattctc gaggcgacgc atccgatgcc acccgctgcg      2520
     agcgcccaac tcaaggctac gatcaaacga gtcctcgggc ccgtcgccac ggcatgtctc      2580
     gcagccgctc cacagcttgc ggtggtgact tcggagacct ctgcctcaga cgcgtccgtc      2640
     tcctcaacag actcgcccgg aaccacgacc tccgcgccta gcttctcgga cccagtgacg      2700
     aaactcattc tctcccgcct tcgtggccac gtcctatcgc gtctcagcgc atcaagtgcc      2760
     tctgaacggg tgcgggctac caccacagcc agtcagaatc tagctggagc cggtatgccg      2820
     gaattcgtta acgaggttgg gaaattggtg gaagaattag agaaggtccg ggaggtggat      2880
     tggctctgcc atggggcgat atatgagggc ttatacgaag aaggcgttcc agcacagtga      2940
//

If you have problems or comments...

PBIL Back to PBIL home page