(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE197

PENCW_13.PE197       Location/Qualifiers
FT   CDS_pept        457355..458722
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824077"
FT                   /gene_name="cia1"
FT                   /orf_name="Pc16g01970"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /protein_id="CAP92867.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317AB"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H7A3"
FT                   /transl_table=1
FT                   /translation="MSPKVTITHLSDLTPPSQERTWLTAPHPTLPLVATCSSDKTIRVY
FT                   SLTNFTLLSTITGGHKRSVRTAAWKPHMTGESVLATGSFDATVGIWRRWDSYGQEGDAG
FT                   MGMSSGDKQIPTDISTAASNGTGTDTADREEDEEEWRFAVLLDGHDSEVKSVSWSASGM
FT                   LLATCSRDKSIWIWEDLDDGDNNFETVAVMQEHGGDVKCVSWHPSEECLASGSYDDTIR
FT                   LWREDLDDWGQVACIKGHGGTVWFLDWEGEETEGNWSGPVADSVSESALSALQAQWRSQ
FT                   RALSGPRLLSCSDDRTVRVWRRQPKESQQTGPLSSATTGIPSIIRPTGTDEVWEEDAVL
FT                   PRAHELPVYAVAWSKRTGLVASTGADGRIALYEERFVTREQEQEQQADSDAMDTTSGDV
FT                   LRTEWVLVGVQDGAHGIYEINHVAWAKRADRRPGGEEEVLVSTADDGSVKVWTLTR"
     atgtctccga aggtcacaat aacacaccta tccgatctga caccaccctc ccaagaacgg        60
     acctggctca cagccccgca cccaaccctg ccactagtcg caacctgtag ctcagacaag       120
     accatccgag tctattccct cacaaacttt actctcctct ccacaattac gggtggccac       180
     aagcgctccg ttcgcacagc agcatggaag ccacacatga cgggggagtc cgtcctcgcg       240
     acaggcagct ttgacgcaac agtcggcatc tggcggcgat gggatagtta cggacaggaa       300
     ggcgatgctg ggatggggat gagcagtggc gataaacaga ttcctaccga tatttcgaca       360
     gcagcttcca acggtacggg caccgacacc gcagaccgcg aagaagacga agaagaatgg       420
     cggttcgcag tcctcctcga cggccacgat agcgaagtca agtccgtatc atggtctgcg       480
     tcggggatgc tgctggcgac gtgctcacgc gacaagtcaa tttggatctg ggaggatctc       540
     gacgacggcg ataacaactt cgagaccgtt gctgtgatgc aggagcacgg cggcgatgtg       600
     aagtgtgttt cgtggcatcc gtcagaggag tgtcttgcta gcgggagcta cgacgatacc       660
     atccggctgt ggcgggagga tctggacgat tggggccagg tagcatgtat caaaggacat       720
     ggcgggactg tctggttttt ggattgggaa ggggaagaaa cagagggaaa ttggagcggg       780
     cctgttgccg actccgtttc cgagtctgct ctgagtgctt tgcaagctca gtggcgttcc       840
     cagagagcgc tttccggccc gcgcctcctg tcctgctcgg atgaccgcac cgtgcgcgtg       900
     tggcggcgcc agccgaagga atcacagcag acggggccgc tttcttctgc gacgacggga       960
     atcccaagta tcattcgacc taccgggacg gatgaggttt gggaggagga tgctgtgctc      1020
     ccgcgtgcgc atgaactacc tgtttatgct gttgcgtgga gtaagcggac tgggcttgtt      1080
     gcttcgactg gtgcggatgg acggattgcg ctctatgagg agcggtttgt tacgcgggaa      1140
     caggagcagg agcagcaggc tgactcggat gctatggata ctacatctgg tgatgtactg      1200
     cggacggagt gggttcttgt cggcgttcag gatggagccc atgggattta cgagattaat      1260
     catgttgctt gggcgaagag ggcggatcgg aggcctgggg gtgaggagga ggtccttgtt      1320
     tcgacggccg atgatggaag tgtcaaggtt tggactttga cgcggtga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page