(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE198

PENCW_13.PE198       Location/Qualifiers
FT   CDS_pept        join(complement(460951..461072),complement(460524..460884),
FT                   complement(459130..460470))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946623"
FT                   /orf_name="Pc16g01980"
FT                   /product="Pc16g01980 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP92868.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI00018317AC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A4"
FT                   /transl_table=1
FT                   /translation="MLLSALSLLLSPLVSASSAADYYVRSLPGAPEGPFLKMHAGHIEV
FT                   DPDTNGNLFFWHFQNRHIANRQRTVIWLNGGPGCSSMDGAFMEVGPYRLQDDHTLKYNE
FT                   GRWDEFANLLFVDNPVGTGFSYANTNSYLHELDEMAAHFVIFLEKFFELFPEYANDDLY
FT                   IAGESYAGQHIPYIAKAIQDRNKGITENGGTKWPLKGLLIGNGWISPADQYPSYFKFIE
FT                   REGLAKPGTSLHHNINALNEVCLSKLETPGAKNKLDVGACELVLQQFLDLTTEDHQCYN
FT                   MYDVRLKDEAKSCGMNWPPDLKNIEPYLQRPDVVKALNINPAKKSGWTECAGMVHMAFT
FT                   AKNSIPSVHLLPGLIESGINVLLFSGDKDLICNHIGTETLIHNMDWKGGTGFETSPGVW
FT                   APRHDWSFEGEPAGIYQSARNLTYVLFYNSSHMVPFDNPRQSRDMLDRFMKVDIASIGG
FT                   QPSDSRIDGEKLPQTAVGGQANSTAAEQNEKERLKQTEMHAYTKSGEAVLIIVIIGVIA
FT                   WGFFIWRSRRTRRGYKGVSNNDMSDSTSVLSRFQNKHSGRDVEAGDFDEAELDQLHSPS
FT                   IEREDYAVGEASDDDDHIISHPETGGNRQSS"
     atgttattat ccgcactgtc actgctgttg agcccgttgg tgtcagccag ttcggctgct        60
     gactattatg tgcgctcgtt acccggggct ccggaaggcc ctttcttgaa gatgcatgct       120
     ggacacatcg aggtcgatcc cgacaccaac ggcaacctgt tcttctggca tttccagaat       180
     cgtcacatcg cgaaccggca gcgcactgtc atttggctga atggtggccc aggatgtagc       240
     tccatggatg gtgcatttat ggaagttggg ccttatcggc tccaggacga ccatacgttg       300
     aagtacaacg agggccggtg ggatgagttt gccaacctgc tcttcgtcga taacccggtc       360
     ggtaccgggt tcagctacgc aaacaccaat agctatctcc atgaactgga tgagatggcc       420
     gctcacttcg ttatcttttt ggaaaagttc tttgaactat tccccgagta tgccaacgat       480
     gacctatata ttgctggtga atcgtacgcc ggccagcaca tcccatatat tgcaaaggcc       540
     attcaagatc gcaacaaggg cattacagag aacggaggca caaagtggcc tctcaagggt       600
     ttgctgatcg gtaacggttg gatctctcct gcagaccagt acccttcgta ctttaagttc       660
     atcgagaggg aaggcctcgc gaaaccgggc acctccctcc accacaacat aaacgcactc       720
     aacgaagtct gtctctcgaa gctggagacc cccggcgcaa agaacaaact ggatgtaggc       780
     gcgtgcgagc tggtcttgca acagttcctc gatctcacca ccgaagatca ccagtgttac       840
     aacatgtacg atgtccgtct caaggacgag gccaaatcct gtggcatgaa ctggccccct       900
     gacctgaaga acattgagcc gtatctccag cgaccggacg ttgtcaaagc cctgaatatc       960
     aacccagcaa agaaatctgg ctggacggag tgcgctggta tggtccacat ggccttcacc      1020
     gcaaagaact ccatcccctc cgtccaccta ctcccaggcc tgatcgaatc gggcatcaac      1080
     gtcctgctct tcagcggcga caaagacctc atctgcaacc atattggaac agagactctg      1140
     atccacaaca tggattggaa gggtggcacc gggtttgaaa cctcccccgg cgtctgggcc      1200
     ccgcgccacg actggtcctt cgaaggcgag ccggccggca tctaccaatc cgcccgtaac      1260
     ctcacctacg tgctcttcta caactccagc cacatggttc cgttcgacaa cccgcgccaa      1320
     agtcgcgaca tgctcgaccg cttcatgaag gtcgatatcg ctagcattgg cggccagcct      1380
     tctgattctc gtatcgacgg tgagaagttg cctcagactg ccgtcggcgg acaggccaat      1440
     agcactgctg ccgagcagaa tgagaaggag aggctgaagc agactgaaat gcacgcgtat      1500
     accaagtctg gcgaggctgt cctcattatt gtgattatcg gtgtaatcgc ttggggcttt      1560
     ttcatctggc gcagtcgtcg tactcgccgg ggctacaagg gcgtctcgaa taatgacatg      1620
     tccgacagta catccgttct cagcagattc cagaacaagc attcaggccg tgatgttgag      1680
     gctggtgatt tcgacgaggc tgagctcgac cagcttcact ctcctagcat tgagcgggag      1740
     gattacgctg ttggcgaagc tagtgatgac gacgaccata ttatctcgca tccggaaact      1800
     ggtggaaacc gccaatcttc ataa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page