(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE199

PENCW_13.PE199       Location/Qualifiers
FT   CDS_pept        join(complement(462344..462656),complement(462227..462244),
FT                   complement(462064..462174),complement(461892..462010),
FT                   complement(461791..461844))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671371"
FT                   /orf_name="Pc16g01990"
FT                   /product="Pc16g01990 protein"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP92869.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniParc:UPI00018317AD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A5"
FT                   /transl_table=1
FT                   /translation="MTRPTFVVEHLDPELGPWSTLEYACIARESHDRGARFLLSSVPAE
FT                   LQMPADLAATKGLEVEQRSVEEIFADRKDKVCLLDPSAQTELSPEDGDNFEVFLFGGIL
FT                   GDDPPRDRTSELRKKGYVGRRLGPKQMTTDTAVRVTRLVVHEKTPLEDIQYVDYPELLI
FT                   NEHERTEMPFRYVKGANEQPIMPDGMVDLIKKDADKSIDFF"
     atgactcgcc caaccttcgt agttgaacat ctggatcccg agctgggccc gtggtccaca        60
     ctcgaatatg cctgcattgc gcgtgaatct cacgaccgcg gggcaagatt tctgctcagc       120
     tctgtgcccg ccgagctgca gatgcccgca gatctggccg ccaccaaggg cctcgaggtt       180
     gagcagcgca gtgtcgagga gatctttgcc gaccgcaagg ataaggtctg cttgttggac       240
     ccctccgctc agaccgagtt gagtcccgag gatggtgata actttgaggt cttcttgttc       300
     ggtggtattc tcggtgacga cccgcctaga gatcgcacct cggaattgag gaagaaggga       360
     tatgtcggcc gccgattggg gcctaagcag atgactacgg atactgctgt gcgagttact       420
     cggttggtcg ttcacgagaa gacacccctc gaggacattc aatatgtcga ctacccagaa       480
     ttgctcatca atgagcatga acgcaccgag atgcctttcc gctatgttaa gggtgccaat       540
     gagcagccta tcatgcccga tgggatggtg gatcttatta agaaggatgc ggacaagtct       600
     attgatttct tctaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page