(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE2

PENCW_13.PE2         Location/Qualifiers
FT   CDS_pept        join(1904..2658,2775..3246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977032"
FT                   /orf_name="Pc16g00020"
FT                   /product="Putative uncharacterized protein Pc16g00020 "
FT                   /protein_id="CAP92672.1"
FT                   /db_xref="UniParc:UPI0001831CCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S1"
FT                   /transl_table=1
FT                   /translation="MPARAHRRAPDPLAGAVNPLPPCRGLSPMAPRGSGLALYAPLPKP
FT                   PGRWPPSTPDPPAVRRTGESVKSPYLPPRRGSSPTPPPKPRLPKPREGAPAPXXXPXAS
FT                   RLALGRPLRAPASPPPHPLHLTRRCGQLPRRANWRPTPPFPGPRSPAGRPSPRGWGRGD
FT                   RRWRTVTWGPACRGVVPRGSPCQGPHRNIPRHPGTPHATRRGHSCGPSLPQPRTVGPGS
FT                   LLHRLTDPIWGVKMQNAVQVAGNCSGGQFLCFGPAFAPPTPILDPAYLPPGPGGALATI
FT                   PAEGACSTVASTKGPASLPAWTGCPLDPRSGPRPTRRANWPIPKGTITPRGRPVYCLSS
FT                   YVPPQLKITALDSPSPPSIPLHPPHHPLHSTAMARNLQPHETHHPQFPFAALRHPPSPS
FT                   PPTTFHRNN"
     atgcccgccc gagcccaccg ccgcgccccc gatcccctcg ccggcgccgt caacccccta        60
     cccccatgca gggggctctc tccaatggcc ccccggggga gcgggcttgc tctgtacgcc       120
     cccctaccaa agcccccggg aaggtggccc ccttcgaccc ccgacccccc agccgttcgg       180
     cgaactggcg aatctgtaaa atcgccatat cttccgcccc gtcgcgggtc ttcaccgacc       240
     ccccctccaa agccccggct ccctaagccc cgggaaggtg cccccgcccc ggngngnnna       300
     cccnnngcct cgcgcctcgc gctcggccgc ccgcttcgcg cgccggcttc gcctccacct       360
     caccccctcc acctcacccg ccggtgcggc caactccccc gccgcgccaa ctggcgcccc       420
     acgcccccct tcccagggcc gcgaagcccc gccggccgcc cctcgccccg gggctggggg       480
     aggggggacc gccggtggcg cacggttacg tggggaccgg cgtgccgggg ggtcgtaccg       540
     cgagggtcac cctgccaggg cccccaccgt aacatccccc gccatcccgg caccccccac       600
     gcaacgcgac gcggccactc ttgcgggccc tcactccctc agccccggac cgttgggccc       660
     gggtcgcttc tacacagact caccgacccc atttggggtg taaaaatgca aaatgcagta       720
     caagtggctg gaaattgctc tggggggcaa tttttgtgct tcgggcctgc cttcgcgccc       780
     cccaccccta tattggaccc ggcatatctt ccccccggtc ccgggggcgc tttagcgacc       840
     ataccggcgg agggggcttg ctctacagtg gcttctacca aaggccccgc ttccctaccc       900
     gcctggacag gctgccccct cgacccccgc tccggacccc ggccaacccg ccgagcaaac       960
     tggccaattc ctaaaggcac cataaccccc cgggggcgtc cggtgtactg tctctcctca      1020
     tatgttccac cgcaattaaa gatcaccgcc ctcgattccc cttcgccgcc ctccatcccc      1080
     ctccatcccc ctcaccaccc actacattcc accgcaatgg ctagaaatct gcaaccgcac      1140
     gaaactcacc accctcaatt ccccttcgcc gcccttcgcc accctccatc cccctcacca      1200
     cccactacgt tccaccgcaa taactag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page