(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE200

PENCW_13.PE200       Location/Qualifiers
FT   CDS_pept        join(463363..463398,463446..463529,463596..463988)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946624"
FT                   /orf_name="Pc16g02000"
FT                   /product="Pc16g02000 protein"
FT                   /protein_id="CAP92870.1"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI00018317AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A6"
FT                   /transl_table=1
FT                   /translation="MNPHQQNKVDINSLSPEEQRLLRLYGKMPTKKDVLQNKLKERKYF
FT                   DSGDYALSKAGKASDVGVTNIGSRHPVPENIPHLTSTSPGANNSANNGSVSSQGGQQVP
FT                   GSISGHPGSVGFQSRSPIKEGGSYLHHGTSISEGEPGSGPASESVRGEQEFSVSPPPAR
FT                   EGVPIRR"
     atgaatcctc atcagcagaa caaggtggac atcaactccc tgagcccaga ggagcagcgc        60
     ctgctgcgcc tctacggcaa gatgcccacc aagaaagacg tcctccagaa caagctcaag       120
     gaacgcaaat acttcgattc gggtgactac gccctcagca aagccggtaa agcctccgac       180
     gtaggcgtca ccaacatcgg gtcacgccac ccagtgccgg agaacatccc gcacctaacc       240
     tcaacttcac cgggtgccaa caactctgcc aacaatggta gtgtcagctc ccaaggtggg       300
     cagcaggtcc ccggcagtat cagcggacac cctggctcgg tcggcttcca aagccgcagc       360
     ccgatcaagg aggggggtag ctacctgcac catggtacca gtatcagtga gggtgagcca       420
     ggctccggtc cagcttctga atcagtgcgg ggtgagcagg agtttagtgt cagtccccct       480
     cctgcgagag agggtgttcc tatccgtcgg tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page