(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE201

PENCW_13.PE201       Location/Qualifiers
FT   CDS_pept        join(465399..465923,465979..466782)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128407"
FT                   /orf_name="Pc16g02010"
FT                   /product="Pc16g02010 protein"
FT                   /protein_id="CAP92871.1"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniParc:UPI00018317AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7"
FT                   /transl_table=1
FT                   /translation="MWLFRVFSSALFLAITVSSIPLAFDVGGKTCGLAFSLSLAAFYFL
FT                   VSLLKVTTPERSWFRSSIIAVLRFIQWAVILVLLIWSLNRFSVDLDSTGPGWVERTFSG
FT                   KRAEDSSIQEWLFGREGLVETVALGNWDRLLRWSTPVFQLAEGFCSLLVIQAAGQITRW
FT                   LVNRGGRSDSWMIGLLVLSATIISSSVYFLWRVLQFPEISNVDAALIGVSVTCAVILCA
FT                   WGIGSGRGNPVESSLLFAYIVLCIYQIFTDYQPSHPVEQIPSPSQVGDFPPLPPIIMAS
FT                   YTTLMHALSLLPSIIHAAFNVITAVFSAVTPSVLISLAYRLLVLYASTRIIPAVRESGA
FT                   RALSQEASIDDTDAAGQVLGFLSYFAPSILIAVYTSLLMQHFASTSQAMGGSGEWWSTQ
FT                   GNGGGNPWRWINLACTISLYAVELWLGETNDLDNGVAGHWKTD"
     atgtggctct ttcgagtctt ttcgtcggcc ttgttcctcg ccatcaccgt ctcgtccatc        60
     ccactagcct tcgatgtggg cggcaagaca tgtggcctgg ccttttcgct gtcattagct       120
     gccttttact tcctggtctc actgctgaag gtcaccaccc ctgaacgatc gtggttccgt       180
     tcctccatca ttgccgtcct tcgtttcata caatgggccg tcatcttggt ccttctgatt       240
     tggtcgctga atcgattctc ggttgatctc gacagcacag ggccgggatg ggtggagcgc       300
     actttcagtg gcaagagggc ggaggattcc tctatccagg aatggctctt tggtcgggaa       360
     ggcctggtgg aaactgtggc cctcggcaac tgggataggc ttctgagatg gtctaccccg       420
     gtcttccagc tggcagaggg attttgcagt ttactggtga ttcaagccgc tgggcaaatt       480
     acccgctggc tcgtcaaccg aggtggtcgt agcgatagct ggatgatcgg cctcttggtt       540
     ttgtccgcta cgatcatctc cagctctgtt tacttcctct ggcgtgttct gcaattcccc       600
     gaaatatcca acgtcgatgc cgccttgata ggagtctccg tcacatgcgc cgtcattctg       660
     tgtgcctggg gtattggaag tggtcgcgga aacccagtcg aaagctctct cctcttcgcc       720
     tacatcgtgc tctgcatcta tcagatcttc acggactatc agccatcgca ccccgtggaa       780
     caaataccct cgccctcgca ggtcggagac ttccccccac tgcctccaat tatcatggcg       840
     tcgtacacaa ccctgatgca cgcgctgtct cttctgccgt cgattatcca tgcagccttc       900
     aacgtcatta ccgccgtctt cagcgctgtc acaccctctg tcctcatctc gctcgcctac       960
     cgcctgctcg tactgtatgc atcgacgcgc atcatcccag cggttcgcga gtctggcgcc      1020
     cgtgcgcttt cccaagaggc ttccattgac gataccgacg cagcaggcca ggtgctaggc      1080
     ttcctgagct acttcgcccc gagcattctc atcgctgtct acaccagtct cctcatgcag      1140
     cacttcgcat caacatcaca agcaatgggt ggcagcggtg aatggtggag cacccaaggc      1200
     aacggtggtg gtaacccatg gcggtggatc aatcttgctt gcacaatatc cctatacgcg      1260
     gtcgagctat ggctgggaga aaccaacgat ctcgacaacg gagtagcggg ccattggaaa      1320
     accgattga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page