(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE202

PENCW_13.PE202       Location/Qualifiers
FT   CDS_pept        join(468079..468137,468204..469236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946625"
FT                   /orf_name="Pc16g02020"
FT                   /product="Pc16g02020 protein"
FT                   /protein_id="CAP92872.1"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniParc:UPI00018317B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H774"
FT                   /transl_table=1
FT                   /translation="MAENVAKKLKTSSPSIGTHNGHFHADEALAVYLLRLLPTYASSPL
FT                   IRTRDPAELEKCHTVVDVGGVYDPAIHRYDHHQRTFSTTFPQRATKLSSAGLVYMHFGK
FT                   AIIAQKLSLPVEHADVDLLYEKLYTDFIEAIDANDNGISAYDQAALTAAGIEKRFKNGG
FT                   ITLASMVGDMNNPDPTSPPGEPQDEDSLFGRASTLIGNAFARKMHHACTSWLPARTTVG
FT                   SAYASRKDVHPSGRIIVLPQGGVPWKEHLYNFEAEASGTKEIDPTVQAYYVLYPENATE
FT                   GAKWRVQCVSVSESSFESRKPLPEAWRGVRDQDLDGVMAAEAEKNGQSKIPEGAVFVHA
FT                   SGFIGGHKTREGAMAMAERSLEL"
     atggctgaaa acgtagcaaa gaagctcaag acctcgtccc cctcgatcgg gacacacaac        60
     ggccacttcc acgccgacga ggccctggcc gtctacctcc tccgcctgct ccccacatac       120
     gcctcctccc ctctcattcg cacgcgcgac ccagccgagt tggagaaatg ccacaccgtc       180
     gtcgacgtgg gcggcgtata cgaccccgcc atccaccggt atgaccacca ccagcgcacc       240
     ttttcaacga ccttcccgca gcgcgccacc aagctctcct ccgccggcct ggtgtacatg       300
     cacttcggta aggcaatcat cgcccagaag ctgtccctgc ccgtggagca cgccgatgta       360
     gacctgctgt acgagaagct gtacacggac ttcatcgaag cgattgacgc caacgacaac       420
     gggatttccg cctacgacca ggccgcactt accgcagctg gaatagagaa gcgcttcaag       480
     aacggcggca tcacgctcgc ctccatggtc ggcgacatga acaacccaga ccccaccagc       540
     ccgcccggcg agccccagga cgaggacagc ctcttcggac gcgctagcac tcttattggc       600
     aacgcgttcg cgcgcaagat gcaccacgcc tgcacatcct ggttgcccgc ccgcacgacc       660
     gtcggctccg cttacgcctc gcgcaaggac gtccacccct ccggccgcat tattgtcctc       720
     ccgcagggcg gcgtgccctg gaaggagcac ctgtacaact ttgaggctga ggcttcggga       780
     accaaggaaa ttgaccccac cgtgcaggcg tactatgttc tctaccccga gaacgctact       840
     gagggagcca agtggcgtgt gcagtgtgtt tccgtctccg agagcagctt tgagtctcgt       900
     aagcctctgc ctgaggcgtg gcgcggtgtg cgcgaccagg accttgacgg ggttatggct       960
     gcggaggctg agaagaatgg ccagagcaag atccccgagg gtgcggtctt tgttcacgct      1020
     agcgggttca tcggtggcca caagacaaga gagggtgcta tggctatggc tgagcgcagc      1080
     cttgagctat ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page