(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE203

PENCW_13.PE203       Location/Qualifiers
FT   CDS_pept        complement(469824..470393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671372"
FT                   /orf_name="Pc16g02030"
FT                   /product="Pc16g02030 protein"
FT                   /protein_id="CAP92873.1"
FT                   /db_xref="UniParc:UPI00018317B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H775"
FT                   /transl_table=1
FT                   /translation="MEHNLLDSLLDVEEQFYNEGYELGTADGAATGYTEGSVFAVEKGF
FT                   EKFVEMGRLYGKALVWAQRLDMKSSEGAAAQADSTTGSTTDTLSLDPSICEDMPSLPPH
FT                   SSRLARNLQTLLELVDPATLDMSNTEEAVNDVDERLKGAATKAKLIQRAMGEREDPAAQ
FT                   VEPKDMSTSGDGSGSIEDISALSIRH"
     atggagcaca atcttctgga cagtctcctt gacgtggagg agcaattcta caatgaggga        60
     tatgagctgg gcaccgcgga tggagccgct accggatata cggaaggcag cgttttcgcc       120
     gttgagaaag gcttcgagaa gttcgtcgag atgggccgat tgtatgggaa ggcattagtc       180
     tgggcacaga gactcgacat gaaatcgtcc gaaggtgccg cagcgcaggc ggatagcaca       240
     acgggtagca caacggatac tctttctctt gatccatcta tctgcgaaga catgcccagt       300
     ctcccaccac acagcagtcg actggccagg aatctccaga cgcttcttga acttgtcgat       360
     ccggccacgc tggatatgag taataccgaa gaagctgtca atgacgtgga cgagcgtctc       420
     aaaggcgccg ctacgaaggc gaagctcatc cagcgcgcaa tgggtgagcg tgaggatcca       480
     gccgcccagg ttgagcccaa ggacatgtcg acttccggag atggctctgg aagcattgag       540
     gatatcagtg cattgagcat tcgtcactga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page