(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE204

PENCW_13.PE204       Location/Qualifiers
FT   CDS_pept        join(470561..470691,470753..472571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946626"
FT                   /orf_name="Pc16g02040"
FT                   /product="Pc16g02040 protein"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92874.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI00018317B2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H776"
FT                   /transl_table=1
FT                   /translation="MTDPILPKAGERNILVTSALPYVNNVPHLGNVVGSVLSADVFARY
FT                   HKACGRRTLYICGTDEYGTATETKALEEKMSPEDLCAKYNKIHQDVYEWFNIGFDHFGR
FT                   TPTQKHTDISQSIFKRLHENGYLGERTAEQPFCEQHGSFLADRFVEGECPRCHYDDARG
FT                   DQCDKCGHLLDPFDLINPRCKIDGAAPVRRETKHIHILLDKLQPEIEKWAHPAIEKGNW
FT                   PRNSRIITESWLKEGLKGRGITRDLKWGVPVPLEGYENKVLYVWFEACIGYPSITANYT
FT                   DDWEKWWRNPEDVQLWQFLGKDNVPFHSVIFPGTQIGTKDKWTMLHHLSTTEYLNYEGG
FT                   KFSKSRGVGVFGTNARETGVPADVWRYFLLKNRPETGDTQFEWAPFVDSNNGELLAKLG
FT                   NLVNRIIKLVTASYGSVIPEFTVPETFNPFLEEVTEHLRQYHEDLEGAHLRAGVQTAMR
FT                   IAEAGNGLIQANRLDNALIANEPERAAAVVGTVLNLIHLLSSVFSPYMPATSKSILEQL
FT                   NAPFLYLPSVEELQSGWKPTSLKAGHKIGKAAYLFSRIDPKKADEWREMFGGSQADRKK
FT                   KEEEAAKLAAKKAAAKAKKKEKKEKGRAGAPEGGVEGSAKGGAEKVSVTTEGKNDEAVE
FT                   KVADGVAQVTLPTS"
     atgacagatc ccatattgcc caaagccggc gagcgcaata tcctcgtgac gagcgctttg        60
     ccctacgtga acaatgttcc ccatctgggc aacgtcgtgg gctccgtgct gagtgccgat       120
     gtctttgcta ggtaccacaa ggcctgtggc cgacgcacat tgtacatctg cggtacagat       180
     gaatacggaa ccgcaaccga gactaaggcg ctggaggaga agatgtcgcc agaagatctg       240
     tgcgccaaat acaacaagat ccaccaggac gtgtacgaat ggttcaacat tggctttgac       300
     cacttcggcc gcacaccaac acagaagcac accgacatct cgcagtcgat tttcaagcgc       360
     ctgcacgaga acggctacct cggtgagcgc accgccgaac agcccttctg cgagcagcac       420
     ggctcgttcc tggctgatcg cttcgttgag ggcgaatgcc cccgctgcca ctacgacgat       480
     gcccgtggag accaatgcga caagtgcggt cacctcctag atccctttga tctcatcaac       540
     ccacgctgca agatcgacgg cgctgccccc gtccgtcgcg agacgaaaca catccacatc       600
     ctacttgaca agctccaacc cgagatcgag aaatgggccc accccgctat tgagaagggt       660
     aactggccta ggaattcgcg cattatcacc gagtcctggt tgaaggaggg tctgaagggc       720
     cgtggtatca cccgagactt gaagtggggt gttcccgtcc cactggaggg gtacgagaac       780
     aaggttctct acgtgtggtt tgaggcttgc atcggctacc cctcgatcac ggctaactac       840
     acagatgact gggagaagtg gtggcgcaac ccggaggatg tgcagttgtg gcagttcttg       900
     ggcaaggaca acgtgccctt ccacagcgtc atcttccccg gtacacagat cggcacgaag       960
     gataagtgga ccatgctcca ccacctgagc acgaccgagt acctcaacta cgagggcggc      1020
     aagttcagta agtcgcgcgg cgtaggtgtg ttcggcacga acgcccgtga aaccggcgtc      1080
     cccgccgacg tgtggcgtta cttcctgctg aagaaccgcc ctgagactgg tgacactcag      1140
     tttgagtggg ccccgttcgt ggacagcaac aacggcgagc tcctcgccaa gctaggcaac      1200
     ctcgtcaacc gtatcatcaa gctcgtcacc gcctcctacg gctccgtcat tccggaattc      1260
     accgtgcccg agaccttcaa cccattccta gaggaagtca ccgaacacct gcgccagtac      1320
     catgaagatc tggaaggcgc gcacctgcgc gccggagtgc agacagccat gcgcatcgcc      1380
     gaggcgggta acgggctgat ccaagcgaac cgactcgaca acgcgctgat tgcgaacgag      1440
     cctgagcgcg ccgctgccgt tgtgggaaca gtacttaacc tgatccacct gctctccagc      1500
     gtgttctctc cgtacatgcc tgcaacctcg aagtcgattc tggagcagtt gaacgcaccc      1560
     ttcctgtacc tccccagtgt ggaagagctc cagtccggct ggaagcctac atcactgaag      1620
     gcgggccaca agatcggcaa ggcagcttac ctgttctctc gtattgatcc caagaaggcg      1680
     gatgagtggc gtgagatgtt tggtgggtcg caggccgacc ggaagaagaa ggaggaggaa      1740
     gctgccaagc tggctgcaaa gaaggctgct gccaaggcca agaagaagga gaagaaggag      1800
     aagggccgtg ctggcgctcc tgaaggtggt gttgaggggt ctgctaaggg tggtgcggag      1860
     aaggtctccg ttaccactga gggcaagaat gatgaggctg ttgaaaaggt cgctgatggg      1920
     gtggcgcaag ttaccctgcc tacctcgtag                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page