(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE206

PENCW_13.PE206       Location/Qualifiers
FT   CDS_pept        complement(475566..476246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128408"
FT                   /orf_name="Pc16g02060"
FT                   /product="Pc16g02060 protein"
FT                   /protein_id="CAP92876.1"
FT                   /db_xref="UniParc:UPI00018317B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H778"
FT                   /transl_table=1
FT                   /translation="MASIGWFPRAKFGPGTTVLFEKPTISAWSIREKQSQHNYQREDWD
FT                   LDPGPSTAEATFHVQQDYGPLAYMRVYMQVPDPSTEFEPREVRRRQAALCPHREVDALK
FT                   CFHQKHFTMTPALLGIKEELQGDDDVVPGGFIVYMVFQHVPGIRLADDQGAPVRGCSIH
FT                   TFFREFDREERDKVRDEFDKNYPRLAELDLTLYSIWADHLVWDPVSSKLYVPSMLIQSC
FT                   SLTT"
     atggcttcaa ttggctggtt tccccgcgcc aaattcggtc cgggcacaac agtcctcttt        60
     gaaaagccaa caatcagcgc atggtcaatc cgagagaaac agtcccagca caactaccag       120
     cgagaggatt gggatctcga tcctggtcca tcaacagccg aggcaacatt ccacgttcag       180
     caggactatg gtccattggc atacatgcga gtatatatgc aggttccaga tccatctacc       240
     gaatttgaac ctcgtgaagt tcgacgtcgc caagccgctc tctgtccaca tcgtgaagtc       300
     gacgccctaa agtgcttcca ccagaaacat ttcactatga cacccgccct cctcgggatc       360
     aaggaggaac tccaaggcga cgatgatgtt gtcccaggtg gtttcatagt ctacatggtg       420
     ttccagcacg tacccggaat tcgacttgcc gatgatcaag gagcgcctgt ccgtgggtgt       480
     tcaatacata cgttctttcg agagttcgac cgtgaggaac gagacaaggt tcgcgatgag       540
     ttcgacaaga attaccctag gctggcggag ttggatttga cactctactc aatctgggcc       600
     gaccatcttg tgtgggatcc tgtctcctcg aagctgtatg tcccttcaat gctgatacag       660
     agctgctcgc taactacatg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page