(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE207

PENCW_13.PE207       Location/Qualifiers
FT   CDS_pept        join(477336..477486,477537..477588,477642..477825,
FT                   477895..478053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946628"
FT                   /orf_name="Pc16g02070"
FT                   /product="Pc16g02070 protein"
FT                   /protein_id="CAP92877.1"
FT                   /db_xref="UniParc:UPI00018317B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H779"
FT                   /transl_table=1
FT                   /translation="MSVPLTKIDSAIAGLSISDEKPETTEKEVKAKSHRRTSSTAEGVW
FT                   NIKDLEEQKMDITLPIETQKTGWKLNTSPSTIEDKDILKMFLVNPPVKKIDLHFPLGLE
FT                   VTARNLKGVTVKDALDAIYKQFKKKADDELDKPYLAGFEWDKEDCWTRLIVHQKKEGAP
FT                   QPSKKSKKKSKKKSKDEA"
     atgtctgttc ctttaaccaa aatcgattct gccattgctg gcttgtccat atctgatgag        60
     aagcctgaga ccaccgagaa ggaggtcaag gccaagtccc acagacggac ctcctcaaca       120
     gcagaaggtg tctggaacat caaggacctt gaagagcaaa agatggacat taccctgcca       180
     attgaaacac aaaagactgg atggaaactc aacacctccc cctcaacaat cgaggacaag       240
     gatatcctca aaatgttcct cgtcaatcca ccggtcaaga agattgacct acacttcccc       300
     cttggcctag aagtcaccgc tcggaacctc aagggcgtca cagtcaagga cgcattagat       360
     gccatctaca aacagttcaa gaagaaggcg gatgacgaac ttgacaaacc ctacctcgct       420
     ggcttcgagt gggacaagga agactgctgg actcggctga tcgtgcacca gaagaaggag       480
     ggtgcaccac agcctagcaa gaagtccaag aagaagtcca agaagaagtc caaggacgag       540
     gcatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page