(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE208

PENCW_13.PE208       Location/Qualifiers
FT   CDS_pept        complement(479140..479646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946629"
FT                   /orf_name="Pc16g02080"
FT                   /product="Pc16g02080 protein"
FT                   /protein_id="CAP92878.1"
FT                   /db_xref="UniParc:UPI00018317B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H780"
FT                   /transl_table=1
FT                   /translation="MAPTPTPAQSHALSIPEIFELILLNLDIRTLLTKASRICHSWSHF
FT                   INSSPRIQWALFFRPLDHALDKPKTQNPLLAETFPSIFDQFECTSKKNDLDTDTTNEKP
FT                   TSNVTLTTFDMIKNPHKWDAYIRPEASWRRMLVQQPPVYTLSLLRSNVGHGGQHLYIYE
FT                   AMVSV"
     atggccccta ccccaacccc agctcaatcc cacgccctct ccatccctga aatcttcgaa        60
     ctgatcctcc tcaatcttga catccgcacc ctcctgacaa aagcaagccg aatctgccac       120
     agctggtccc acttcatcaa ttcctccccg cgcatccaat gggccctatt cttccgaccc       180
     ctcgaccatg cattggataa accaaagacc cagaacccac tactagcaga aacctttccg       240
     tccatcttcg accagttcga gtgtaccagt aaaaagaatg atctcgacac cgatactaca       300
     aacgaaaaac ccacctccaa tgtcacattg accaccttcg acatgatcaa gaacccgcac       360
     aaatgggacg catacatcag accggaagcc agctggcgtc gtatgctggt ccagcagccg       420
     cccgtgtata cgctgtcgct gctaaggagt aatgtcgggc atggcgggca gcatttgtac       480
     atttatgagg cgatggtgag tgtctag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page