(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE209

PENCW_13.PE209       Location/Qualifiers
FT   CDS_pept        join(complement(481734..483583),complement(480937..481445),
FT                   complement(479870..480885))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128409"
FT                   /orf_name="Pc16g02090"
FT                   /product="Pc16g02090 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP92879.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00018317B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H781"
FT                   /transl_table=1
FT                   /translation="MALSRRDLVLAGVGVFIAWGLVVRWLPILRYLGYAVTLGAILSSV
FT                   GLLGLITLTIRHQNDKANTKNVSVAFIKPNQWRKEVLNVRRSTRYRPRPLYPQSFVVSE
FT                   RIDELLSLITRDFISSWYRSISPNPIFANEVDRTIRVALENLRDRLVAEDMVSLIVSRI
FT                   FPIVTSHLKEFDIAERSVRGRNLNRNVTESGELDLAIANKYRDGRLHPAVATSASDQKA
FT                   VQQDYLRKLAVGLLPQLFPESVLNSRIVSVLIREIISCAVLIPIVTALSDPDTWNQLME
FT                   AYGRTALHDRKTVRKLRAALDQHASPTPKSKRGQPFPRLSATDSERAFERFVRAIRKCN
FT                   NLSDARRFRALVSSQLKQESVVEGQDQVYLKRLETGKRVLDQKVAKLAKPGEDSHVPPA
FT                   LDPRPEIPSKTHESSLVDVMHSASGLSYFMEFMDRQKLMSLVQFWVVVDGFRNPLEDDF
FT                   GDEAAPTSLAWKPADRNDLALISETYLSKPELKVSEESRRAVKTFLSAGKRATPEQYRK
FT                   ARMVVLTTQSAILEHLQDTYYPKFKESDLYWKYLASDEASAAQAPVRQPSPIAVTFEAP
FT                   ERRPLPPLLSRTSSQPGLRPSKDLRRAAVSSGDVRGMGKLFSSEIPQVDNRNERTKKSI
FT                   ASLGLVDHASRLGVFDDDLFPDQQKFIEDEYEEPDGVDEKDSADEVHEAAPGDLGLTEA
FT                   IEALSVDIDKLAAQDAVVQALTRKAELTNNTAELRILRKSKASIQREMHRKEMQRQQYI
FT                   LQESDNSLFGRSTVSIKSIVVGKEEDDGREFAMYVVEVQRNAGEQMPAASWVVARRYSE
FT                   FHDLHQKLRQRYPSVRHLEFPRRRVVMKLQKEFLHKRRLALEAYLQKLLLLPEVCRSRD
FT                   LRAFLSQRAILPRMEIARDNEGETKDLVTRIYNSVADGMDDFLGNFGVLDQLSTAGQNL
FT                   ISAATQQASSAIPESSLATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEAFELNR
FT                   GNNWLRGRAVVVVLHQLLGGTIERKVRDGARGLVQDDSLLKYISLARDTLWPGGILRKA
FT                   PPRSAAERLNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHLVFT
FT                   ILDEIVLVLFGSAGRPR"
     atggccctta gtcgccgtga cctagttttg gcgggcgtcg gcgtattcat cgcttggggt        60
     cttgtggttc gctggctgcc gatcctccgg tatctaggat atgcggtgac actgggtgcc       120
     atcctatctt ctgttggtct tttagggctt atcacattga caatccgaca tcagaatgac       180
     aaagccaaca ccaagaacgt ttcagtggct ttcataaaac ccaaccaatg gcgaaaggaa       240
     gtgctgaatg tccgtcggag cacgcgatac cggccccggc cactgtatcc tcagtccttt       300
     gtcgtatcgg aaaggatcga tgaacttcta tctctcatta cccgagactt tatttcctcg       360
     tggtatcgca gtatcagtcc gaacccaata tttgccaatg aggttgatcg aacgattcgt       420
     gtcgcccttg aaaacctccg ggataggttg gttgcggagg acatggtctc gctaatcgta       480
     tcgcggatct ttcctattgt aacatcacac ctcaaagaat ttgacattgc cgagcgttct       540
     gtccgggggc gcaatctcaa tcggaatgtg accgagtccg gagagcttga tctggccatt       600
     gcaaacaaat accgtgatgg gcgtttacat cccgctgttg caacctctgc gtccgatcaa       660
     aaggctgttc aacaggacta cctacgcaag ctagcagttg gactcttacc ccagctattc       720
     ccggaaagcg tgctaaacag tcgaatcgtg tctgttctga ttcgagaaat catctcatgc       780
     gctgtgctta ttccgatagt cactgcatta tcagacccag acacgtggaa ccagttaatg       840
     gaagcatatg gccgtacagc tttgcacgat cggaagactg tacgcaaact gcgcgccgct       900
     ttggaccaac atgcgtcacc tacacctaag tccaagcgtg ggcaaccatt tccacgactg       960
     tcagcaaccg attcagagcg agcctttgag cgctttgtga gggcaatcag gaaatgtaat      1020
     aacctctccg atgcccgtcg gtttcgtgcc ctcgtttcca gtcaattgaa acaagagagt      1080
     gtggtcgagg gtcaggatca ggtctatctg aagcgtctgg aaacgggaaa acgtgttctt      1140
     gatcagaaag tggctaaact cgcgaagcct ggcgaagatt cccatgtgcc tccagcacta      1200
     gaccctcgac ctgagatccc atctaaaacg catgaatcgt ccctggtcga cgtgatgcac      1260
     agcgcatctg gactttctta tttcatggag tttatggatc gccaaaagct gatgtctctt      1320
     gttcaattct gggttgttgt agatgggttc cgcaacccac ttgaagatga ctttggagat      1380
     gaggcagcgc ctacttcatt agcatggaag ccagcagaca gaaatgacct agctctgatc      1440
     agtgaaacat atctctcaaa gccagaactg aaggtctctg aagagtctcg ccgggcagtc      1500
     aagacattcc tgagtgcagg aaagcgtgcc accccggaac aataccgaaa agcgcgaatg      1560
     gtggttttaa caacccagtc tgctatttta gagcatctcc aagataccta ctatcccaag      1620
     ttcaaggagt ctgatctgta ctggaagtat cttgcgtctg atgaagcatc tgctgcccag      1680
     gcgccagttc gtcaaccctc ccccattgca gtcacttttg aagctcccga gaggcgacct      1740
     ctcccgcctt tgttgtcacg aacgagctcc cagccgggat tgagaccatc caaagacctt      1800
     cgacgggccg ctgtctcgtc tggcgatgtg cggggcatgg gaaaattatt ctcgtccgaa      1860
     atcccccagg ttgacaaccg gaatgaaaga actaagaaaa gcatcgcatc gcttggtctg      1920
     gtcgatcatg cgtcccgact tggtgtgttt gatgacgact tatttccgga tcaacagaaa      1980
     ttcatcgaag atgaatacga agaaccagac ggcgtggatg aaaaagactc agcagatgaa      2040
     gtgcatgaag ctgcaccggg tgacttaggt ctaacggaag cgattgaggc actctcggtg      2100
     gatatcgaca agcttgcagc ccaggacgcc gtggtccaag cattgacacg aaaagccgaa      2160
     ctgacaaaca acaccgcgga attgagaatc ctgcgcaagt ccaaggctag catccagcgc      2220
     gaaatgcatc gtaaggaaat gcagcggcaa cagtacattc tccaggaaag cgataacagc      2280
     ttgtttgggc gatcgaccgt tagcatcaag tctattgtcg tagggaaaga ggaggatgat      2340
     ggccgcgaat tcgctatgta cgttgtggag gttcaaagaa atgcgggcga gcaaatgcct      2400
     gctgcatcgt gggtcgttgc acgacgatac agcgagttcc atgatctgca ccaaaagcta      2460
     cgccaacgct acccctccgt gcggcacttg gaattccccc ggcggcgcgt cgtcatgaag      2520
     ttacagaaag agttccttca caagcgacga ctcgctctcg aagcctatct gcagaaactc      2580
     ctcctcctgc cagaggtctg tcgcagccgc gatctacgtg cattcctatc ccagcgtgcc      2640
     attttgcccc gcatggaaat tgcccgcgac aacgaaggtg aaaccaaaga ccttgtcacc      2700
     cgtatctaca actccgtcgc agatggcatg gatgacttcc tcggcaactt cggcgtccta      2760
     gaccaactat ctaccgcagg ccagaatctc atatcagccg ctacccagca agccagcagc      2820
     gcgataccag agtccagcct cgcaaccgaa gacgccgtca cagccgccga agccgaagcg      2880
     gaactaaatg ccttcgaaga ccgcgagctc gagcccttca tcaagcccat ctgcgatctc      2940
     ttcctcgaag ccttcgagct gaaccgcggc aacaactggc tgcgcggccg tgccgtcgtt      3000
     gttgtcttgc accagctcct cggcgggaca atagagcgca aggtccgcga cggagcgcgc      3060
     ggcctggtac aggatgattc acttctcaag tacatttctc tcgctcgaga taccctctgg      3120
     cccggcggca tactccgaaa agcccctcct cgttcggctg ctgagcgtct caacagtcgt      3180
     gctgaggcca ctgtggtctt ggctaccctc atcccggatc tggcaggtaa tgttgtcggc      3240
     agagctaatg cgcaggctgc tgcccgccgc atctttgcca cgctgaacaa tcagcatctc      3300
     aatacccatc tcgtttttac gattcttgac gagatcgtct tggttctctt tgggagtgcg      3360
     ggccgtcctc gatga                                                       3375
//

If you have problems or comments...

PBIL Back to PBIL home page